TkAUNG044530 | RubberDandelionOmics

Gene overview

TkAUNG044530

Reference: TK1151 Chr: ChrUn Coordinates: 12389628-12391826 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1589 bp · TkAUNG044530|TK1151|cDNA

ATGTTTCCAAAACGATCTTTTAGTGAGGAGGAAGGGAATGATTCTGGACATTCCAATCAAGAATCAGATGGAAGTGGGTCTTCAAATGATGCTAGAAACAAGTTGCAGAGATTTTCTCATGAAGAATTTGGGGCAACATTGGAACCATTAATTCGAGGAGTGGTGCAAGATGAGGTGCAACTTGCATTTCAAAAGATCTTTGGTACTGCTACATTACAAAGGTTATCTCCTTCTGATGGTACAACTACAACATTCCTACA...

CDS

Download CDS FASTA

1236 bp · TkAUNG044530|TK1151|CDS

ATGTTTCCAAAACGATCTTTTAGTGAGGAGGAAGGGAATGATTCTGGACATTCCAATCAAGAATCAGATGGAAGTGGGTCTTCAAATGATGCTAGAAACAAGTTGCAGAGATTTTCTCATGAAGAATTTGGGGCAACATTGGAACCATTAATTCGAGGAGTGGTGCAAGATGAGGTGCAACTTGCATTTCAAAAGATCTTTGGTACTGCTACATTACAAAGGTTATCTCCTTCTGATGGTACAACTACAACATTCCTACA...

Protein

Download Protein FASTA

411 aa · TkAUNG044530|TK1151|PROTEIN

MFPKRSFSEEEGNDSGHSNQESDGSGSSNDARNKLQRFSHEEFGATLEPLIRGVVQDEVQLAFQKIFGTATLQRLSPSDGTTTTFLQLRFQTSLLATYFTGNKIESEDKSSIKIGLYDGVSNEIVTSGPLSSQKIILVALDGDFPFDDHEDWPQSEFDSKVISARDGKRPLLTGDLVVTLKNGVANLGNVVYTDNSSWRRSRKFRLGAKVENANVGVRIREARSQAFMVKDQRGESYKKHHPPRLGDDTWRLEKIAKDGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG044530`
TK1151 ID	TkAUNG044530
OH-1004 ID	LXL04_001272
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 95.620 / OH-1004 89.318 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG044530

Location ChrUn:12389628-12391826 (+)

Description Similar to CBP60G: Calmodulin-binding protein 60 G

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57580`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At4g25800`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release
`At5g26920`	Transcription activator that binds DNA in a sequence-specific manner, 5'-GAAATTTTGG-3', to promote the expression of target genes.	Arabidopsis CaM binding protein CBP60g contributes to MAMP-induced SA accumulation and is involved in disease resistance against Pseudomonas syringae.2009 · DOI: 10.1371/journal.ppat.1000301 CBP60g and SARD1 play partially redundant critical roles in salicylic acid signaling.2011 · DOI: 10.1111/j.1365-313x.2011.04655.x Calmodulin-binding protein CBP60g is a positive regulator of both disease resistance and drought tolerance in Arabidopsis.2012 · DOI: 10.1007/s00299-012-1247-7 Co-expression analysis identifies putative targets for CBP60g and SARD1 regulation.2012 · DOI: 10.1186/1471-2229-12-216 The plant-specific transcription factors CBP60g and SARD1 are targeted by a Verticillium secretory protein VdSCP41 to modulate immunity.2018 · DOI: 10.7554/elife.34902
`At2g18750`	Transcription activator that binds DNA in a sequence-specific manner, likely 5'-GAAATTTTGG-3', to promote the expression of target genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001272 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009697 salicylic acid biosynthetic process Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010112 regulation of systemic acquired resistance Biological Process

GO:0010224 response to UV-B Biological Process

KEGG gene cross-reference

ath:AT2G18750

ath:AT4G25800

ath:AT5G26920

ath:AT5G57580

ghi:107899061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · TkAUNG044530 · TK1151

Cytoplasm0.107

Rank 2 · TkAUNG044530 · TK1151

Cell membrane0.025

Rank 3 · TkAUNG044530 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkAUNG044530 · TK1151

Plastid0.011

Rank 5 · TkAUNG044530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20451Calmod_bind_M50-68 aa

PF07887Calmodulin_bind86-232 aa

PF20451Calmod_bind_M245-309 aa

PF20452Calmod_bind_C314-370 aa

PF19895DUF6368324-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG044530	`PF20451`	Calmod_bind_M	50	68	7.8e-20	71.9
TkAUNG044530	`PF07887`	Calmodulin_bind	86	232	4.5e-52	176.8
TkAUNG044530	`PF20451`	Calmod_bind_M	245	309	7.8e-20	71.9
TkAUNG044530	`PF20452`	Calmod_bind_C	314	370	1.1e-13	51.8
TkAUNG044530	`PF19895`	DUF6368	324	366	0.22	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKL6`	Arabidopsis thaliana	sp\|Q9FKL6\|CB60B_ARATH Calmodulin-binding protein 60 B	44.200%	Swiss-Prot	Medium
`Q0WVV6`	Arabidopsis thaliana	sp\|Q0WVV6\|CB60D_ARATH Calmodulin-binding protein 60 D	41.500%	Swiss-Prot	Medium
`F4K2R6`	Arabidopsis thaliana	sp\|F4K2R6\|CB60G_ARATH Calmodulin-binding protein 60 G	42.300%	Swiss-Prot	Medium
`C0SV51`	Arabidopsis thaliana	sp\|C0SV51\|CB60C_ARATH Calmodulin-binding protein 60 C	41.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card