Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1367 bp · TkAUNG042210|TK1151|cDNA
CGCCATCTCTACACAGTTAGATTGAGCTGTTTTTACTCTGCTCTCCTAATCACTGAGGTAAGTCAAATCCCGTTCGATTCTGCACTGTTAATTTGGGTTCAATCACTTTATTGCACAATGAAGAACCTTGATGATCTGAAGTTTGAAGTTGGACAACTGGCTGAAACCAGAACATTTGTAGAAGGATACCGCAGTGCTTGGTTCAGATGCAAGATCAAGGATATAAACCTGAAAAAGAATCGGATTTTGCCTGAGTACTA...
666 bp · TkAUNG042210|TK1151|CDS
CGCCATCTCTACACAGTTAGATTGAGCTGTTTTTACTCTGCTCTCCTAATCACTGAGGTAAGTCAAATCCCGTTCGATTCTGCACTGTTAATTTGGGTTCAATCACTTTATTGCACAATGAAGAACCTTGATGATCTGAAGTTTGAAGTTGGACAACTGGCTGAAACCAGAACATTTGTAGAAGGATACCGCAGTGCTTGGTTCAGATGCAAGATCAAGGATATAAACCTGAAAAAGAATCGGATTTTGCCTGAGTACTA...
Protein
Download Protein FASTA221 aa · TkAUNG042210|TK1151|PROTEIN
RHLYTVRLSCFYSALLITEVSQIPFDSALLIWVQSLYCTMKNLDDLKFEVGQLAETRTFVEGYRSAWFRCKIKDINLKKNRILPEYYDFPEEDITWTKIYELPDYGRKSKQIKKQLMVRPPYPPMHHKSEMPPVNSITEVCVVFNGEWKVGDLVDWYKDDCYWCSRVMKILTDDKVQIQLPLPPTGQGGVMKHFVRIYKAILTLVSNRRLDVAYHERQDFM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG042210 |
|---|---|
| TK1151 ID | TkAUNG042210 |
| OH-1004 ID | LXL04_003307 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 87.900 |
| Protein coverage (%) | TK1151 85.973 / OH-1004 21.319Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG042210 |
|---|---|
| Location | ChrUn:11741909-11744056 (-) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009908 flower development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:0005634 nucleus Cellular Component GO:0031010 ISWI-type complex Cellular Component GO:0003677 DNA binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G28420 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05641Agenet51-123 aaPF05641Agenet151-179 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG042210 | PF05641 | Agenet | 51 | 123 | 7.6e-10 | 39.8 |
| TkAUNG042210 | PF05641 | Agenet | 151 | 179 | 7.6e-10 | 39.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.