TkAUNG039270 | RubberDandelionOmics

Gene overview

TkAUNG039270

Reference: TK1151 Chr: ChrUn Coordinates: 10950832-10953629 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

900 bp · TkAUNG039270|TK1151|cDNA

CCGCGGGCAAAGAAGAAATGGAGCAATTTCGGCAAGTCTCACAACGAAAGAGATCGGCACAAGTCTCAGCACGCCGTAAGCGAGGACGACGATGAAGCCAGCAAGCACGCTATTGCCGTCGCCGCCGCCACCGCTGCGGTAGCGGAGGCTGCTGTTGCCGCCGCTCAGGCCGCCGCCGCTGTGGTCCACCTCACAAGCAGCGGGCGGAACATTTCCGCTGCCGGAAGTGGTTACGCCACGGCTTGCGTTAGTCAGAATGG...

CDS

Download CDS FASTA

900 bp · TkAUNG039270|TK1151|CDS

CCGCGGGCAAAGAAGAAATGGAGCAATTTCGGCAAGTCTCACAACGAAAGAGATCGGCACAAGTCTCAGCACGCCGTAAGCGAGGACGACGATGAAGCCAGCAAGCACGCTATTGCCGTCGCCGCCGCCACCGCTGCGGTAGCGGAGGCTGCTGTTGCCGCCGCTCAGGCCGCCGCCGCTGTGGTCCACCTCACAAGCAGCGGGCGGAACATTTCCGCTGCCGGAAGTGGTTACGCCACGGCTTGCGTTAGTCAGAATGG...

Protein

Download Protein FASTA

299 aa · TkAUNG039270|TK1151|PROTEIN

PRAKKKWSNFGKSHNERDRHKSQHAVSEDDDEASKHAIAVAAATAAVAEAAVAAAQAAAAVVHLTSSGRNISAAGSGYATACVSQNGAGYRSPEEWAAVTIQSHFRAYLSRRALRALKALVKLQALVRGHLVRKQTAYALRRLQALVRAQVRARAGRAQLYDSPHSSMKSSHFNHPGPATPEKFEQAIRARSIKHEQLVVLKRNGSKSSSSIDHDQEKSRASRMLVDNRMNGRLWEQGSFTRPLPTDDDRSDKILEVDMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG039270`
TK1151 ID	TkAUNG039270
OH-1004 ID	LXL04_029639
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	41.800
Protein coverage (%)	TK1151 83.946 / OH-1004 28.107 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG039270

Location ChrUn:10950832-10953629 (-)

Description Similar to MIZ1: Protein MIZU-KUSSEI 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23060`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g62070`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g00820`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g49260`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	Calcium channels activated by hydrogen peroxide mediate abscisic acid signalling in guard cells.2000 · DOI: 10.1038/35021067 A defined range of guard cell calcium oscillation parameters encodes stomatal movements.2001 · DOI: 10.1038/35082575 CO(2) signaling in guard cells: calcium sensitivity response modulation, a Ca(2+)-independent phase, and CO(2) insensitivity of the gca2 mutant.2006 · DOI: 10.1073/pnas.0602225103 Combinatorial interactions of multiple cis-elements regulating the induction of the Arabidopsis XERO2 dehydrin gene by abscisic acid and cold.2008 · DOI: 10.1111/j.1365-313x.2007.03399.x Calcium elevation-dependent and attenuated resting calcium-dependent abscisic acid induction of stomatal closure and abscisic acid-induced enhancement of calcium sensitivities of S-type anion and inward-rectifying K channels in Arabidopsis guard cells.2009 · DOI: 10.1111/j.1365-313x.2009.03872.x
`At1g01110`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029639 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010091 trichome branching Biological Process

GO:0010274 hydrotropism Biological Process

GO:0051592 response to calcium ion Biological Process

GO:1901020 negative regulation of calcium ion transmembrane transporter activity Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT2G41660

ath:AT4G14750

ath:AT4G23060

ath:AT5G07240

ath:AT5G62070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.387

Rank 1 · TkAUNG039270 · TK1151

Cell membrane0.374

Rank 2 · TkAUNG039270 · TK1151

Nucleus0.364

Rank 3 · TkAUNG039270 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkAUNG039270 · TK1151

Golgi apparatus0.040

Rank 5 · TkAUNG039270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26137Toxin_SdpC22-64 aa

PF25848Rodlin35-94 aa

PF24609IQ_SCN5A_C91-118 aa

PF00612IQ96-115 aa

PF00612IQ118-135 aa

PF26137Toxin_SdpC138-154 aa

PF00612IQ143-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG039270	`PF26137`	Toxin_SdpC	22	64	0.59	10.8
TkAUNG039270	`PF25848`	Rodlin	35	94	4.3	7.9
TkAUNG039270	`PF24609`	IQ_SCN5A_C	91	118	0.0091	16.2
TkAUNG039270	`PF00612`	IQ	96	115	2.3e-10	40.0
TkAUNG039270	`PF00612`	IQ	118	135	2.3e-10	40.0
TkAUNG039270	`PF26137`	Toxin_SdpC	138	154	0.59	10.8
TkAUNG039270	`PF00612`	IQ	143	149	2.3e-10	40.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2NNE0`	Arabidopsis thaliana	sp\|Q2NNE0\|IQD22_ARATH Protein IQ-DOMAIN 22	45.000%	Swiss-Prot	Medium
`Q9FIT1`	Arabidopsis thaliana	sp\|Q9FIT1\|IQD23_ARATH Protein IQ-DOMAIN 23	47.700%	Swiss-Prot	Low
`F4JHN2`	Arabidopsis thaliana	sp\|F4JHN2\|IQD17_ARATH Protein IQ-DOMAIN 17	50.000%	Swiss-Prot	Low
`Q9ASW3`	Arabidopsis thaliana	sp\|Q9ASW3\|IQD21_ARATH Protein IQ-DOMAIN 21	61.300%	Swiss-Prot	Low
`Q9MAM4`	Arabidopsis thaliana	sp\|Q9MAM4\|IQD18_ARATH Protein IQ-DOMAIN 18	56.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card