RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG039080
Reference: TK1151 Chr: ChrUn Coordinates: 10875967-10877430 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1176 bp · TkAUNG039080|TK1151|cDNA

ATGGACCCAATCAAAAAACGCAAAATCGACGAGAACGGCGTCGGCATAGCAGAGGCGGACGCCTTCAATCCCCTCATACTCACCGTCGACGACGCCCGCAGAATGCTCGAACCGTTTACCCACGAGCAGCTATTGGGAATTGTCCAAAATGCCATTCTCCGCCACCCTGATGTCCTCGACGCCGTCCGATCCGTTGCCAACCAAGATACGACGCAGCGGAAGCTTTTCATTCGCGGTCTCGGCTGGGAAACCACCACGGA...

CDS

Download CDS FASTA

1176 bp · TkAUNG039080|TK1151|CDS

ATGGACCCAATCAAAAAACGCAAAATCGACGAGAACGGCGTCGGCATAGCAGAGGCGGACGCCTTCAATCCCCTCATACTCACCGTCGACGACGCCCGCAGAATGCTCGAACCGTTTACCCACGAGCAGCTATTGGGAATTGTCCAAAATGCCATTCTCCGCCACCCTGATGTCCTCGACGCCGTCCGATCCGTTGCCAACCAAGATACGACGCAGCGGAAGCTTTTCATTCGCGGTCTCGGCTGGGAAACCACCACGGA...

Protein

Download Protein FASTA

391 aa · TkAUNG039080|TK1151|PROTEIN

MDPIKKRKIDENGVGIAEADAFNPLILTVDDARRMLEPFTHEQLLGIVQNAILRHPDVLDAVRSVANQDTTQRKLFIRGLGWETTTDKLRALFSSYGELDEAVVILDKATGKSKGYGFITFKHIDGAIMALKEPSKKIDGRMTVTQLAAAGVSGVGDVSMRKIYVSNVPYDMPAERLLHHFSMYGEVEEGPLGFDKATGKSKGFALFVYKTAVAARASLVDPIKNIDGHQLNCKLAIDGKRGKPPGVGSMVPMGVQGGGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG039080
TK1151 IDTkAUNG039080
OH-1004 IDLXL04_027332
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)64.400
Protein coverage (%)TK1151 62.148 / OH-1004 60.577
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG039080
LocationChrUn:10875967-10877430 (-)
DescriptionSimilar to UBA2C: UBP1-associated protein 2C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g15010 Heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein that acts as a component of a complex regulating the turnover of mRNAs in the nucleus. No verified direct reference in this release
At2g41060 Heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein that acts as a component of a complex regulating the turnover of mRNAs in the nucleus. No verified direct reference in this release
At3g56860 Heterogeneous nuclear ribonucleoprotein (hnRNP)-like protein that acts as a component of a complex regulating the turnover of mRNAs in the nucleus.
UBA1 and UBA2, two proteins that interact with UBP1, a multifunctional effector of pre-mRNA maturation in plants.2002 · DOI: 10.1128/mcb.22.12.4346-4357.2002
At2g22090 Acts as a component of a complex regulating the turnover of mRNAs in the nucleus.
UBA1 and UBA2, two proteins that interact with UBP1, a multifunctional effector of pre-mRNA maturation in plants.2002 · DOI: 10.1128/mcb.22.12.4346-4357.2002

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0265800 RNA-binding protein that binds to a cis-localization element or zipcode, within the 5'-CDS of prolamine RNA.
Characterization of RNA binding protein RBP-P reveals a possible role in rice glutelin gene expression and RNA localization.2014 · DOI: 10.1007/s11103-014-0191-z
RNA-Binding Protein RBP-P Is Required for Glutelin and Prolamine mRNA Localization in Rice Endosperm Cells.2018 · DOI: 10.1105/tpc.18.00321
Zipcode RNA-Binding Proteins and Membrane Trafficking Proteins Cooperate to Transport Glutelin mRNAs in Rice Endosperm.2020 · DOI: 10.1105/tpc.20.00111
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027332 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009693 ethylene biosynthetic process Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0010150 leaf senescence Biological Process
GO:0012501 programmed cell death Biological Process
GO:0048255 mRNA stabilization Biological Process
GO:0051028 mRNA transport Biological Process
GO:0005634 nucleus Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0003729 mRNA binding Molecular Function
GO:0035925 mRNA 3'-UTR AU-rich region binding Molecular Function
KEGG gene cross-reference
ath:AT2G22090
ath:AT2G41060
ath:AT3G15010
ath:AT3G56860
dosa:Os01g0265800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.823
Rank 1 · TkAUNG039080 · TK1151
Cytoplasm0.259
Rank 2 · TkAUNG039080 · TK1151
Cell membrane0.028
Rank 3 · TkAUNG039080 · TK1151
Endoplasmic reticulum0.019
Rank 4 · TkAUNG039080 · TK1151
Mitochondrion0.016
Rank 5 · TkAUNG039080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08559Cut833-70 aa
PF16367RRM_773-131 aa
PF00076RRM_175-141 aa
PF28441RRM_1177-141 aa
PF16367RRM_7161-219 aa
PF00076RRM_1163-219 aa
PF28441RRM_11169-209 aa
PF10899AbiGi171-227 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG039080PF08559Cut833700.3411.2
TkAUNG039080PF16367RRM_7731311.4e-0732.1
TkAUNG039080PF00076RRM_1751413.8e-2691.5
TkAUNG039080PF28441RRM_11771410.005717.7
TkAUNG039080PF16367RRM_71612191.4e-0732.1
TkAUNG039080PF00076RRM_11632193.8e-2691.5
TkAUNG039080PF28441RRM_111692090.005717.7
TkAUNG039080PF10899AbiGi1712270.4211.3
TkAUNG039080PF28610Glycine-rich_protein_DOT12293710.02214.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LKA4Arabidopsis thalianasp|Q9LKA4|UBA2C_ARATH UBP1-associated protein 2C57.100%Swiss-ProtHigh
O80678Arabidopsis thalianasp|O80678|UBA2B_ARATH UBP1-associated protein 2B48.600%Swiss-ProtMedium
Q9LES2Arabidopsis thalianasp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A46.400%Swiss-ProtMedium
Q9SHZ6Arabidopsis thalianasp|Q9SHZ6|UBA1A_ARATH UBP1-associated proteins 1A43.300%Swiss-ProtLow
Q9LJ04Oryza sativa subsp. japonicasp|Q9LJ04|RBPP_ORYSJ RNA-binding protein P43.300%Swiss-ProtMedium

JBrowse

View in Genome Browser