TkAUNG039070 | RubberDandelionOmics

Gene overview

TkAUNG039070

Reference: TK1151 Chr: ChrUn Coordinates: 10868499-10871042 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · TkAUNG039070|TK1151|cDNA

ATGAAGTTGAACCCTCATGTCTCCAGACTCGCTCTCTACGATATAGCCGGCACACCAGGCGTTGCTGCTGATGTCAGCCACATTAACACCAGATCTGAGGTGCGGTTCTTTTCCTCTCCAACTTTCAGTTTGAATTTCTTGAGAGGGTCAGACATAGTCATCATTCCAGCTGGTGTGCCCAGAAAGCCTGGCATGACTCGTGATGACCTCTTCAAGATCAATGCTGGCATTGTCAAATCTCTTTGTGAGGCCATTGCCAT...

CDS

Download CDS FASTA

885 bp · TkAUNG039070|TK1151|CDS

ATGAAGTTGAACCCTCATGTCTCCAGACTCGCTCTCTACGATATAGCCGGCACACCAGGCGTTGCTGCTGATGTCAGCCACATTAACACCAGATCTGAGGTGCGGTTCTTTTCCTCTCCAACTTTCAGTTTGAATTTCTTGAGAGGGTCAGACATAGTCATCATTCCAGCTGGTGTGCCCAGAAAGCCTGGCATGACTCGTGATGACCTCTTCAAGATCAATGCTGGCATTGTCAAATCTCTTTGTGAGGCCATTGCCAT...

Protein

Download Protein FASTA

294 aa · TkAUNG039070|TK1151|PROTEIN

MKLNPHVSRLALYDIAGTPGVAADVSHINTRSEVRFFSSPTFSLNFLRGSDIVIIPAGVPRKPGMTRDDLFKINAGIVKSLCEAIAIHCPNALINMISNPVNSTVPIAAEVFKSKGVYDPRKLFGVTTLDVVRAKTFYAGKAKVDVADVNVPVIGGHAGVTILPLFSQATPKANLSDEEINALTKRTQDGGTEVVEAKAGKGSATLSMAYAGAVFADACIKGLNGVPDVVECSYVQSTVTELPFFASKVRLGKNGVEEVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG039070`
TK1151 ID	TkAUNG039070
OH-1004 ID	LXL04_001929
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.300
Protein coverage (%)	TK1151 99.320 / OH-1004 78.763 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG039070

Location ChrUn:10868499-10871042 (+)

Description Similar to At1g53240: Malate dehydrogenase 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53240`	Catalyzes a reversible NAD-dependent dehydrogenase reaction involved in central metabolism and redox homeostasis between organelle compartments (Probable).	No verified direct reference in this release
`At3g15020`	Catalyzes a reversible NAD-dependent dehydrogenase reaction involved in central metabolism and redox homeostasis between organelle compartments (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001929 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006108 malate metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G53240

ath:AT3G15020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkAUNG039070 · TK1151

Nucleus0.226

Rank 2 · TkAUNG039070 · TK1151

Peroxisome0.130

Rank 3 · TkAUNG039070 · TK1151

Mitochondrion0.117

Rank 4 · TkAUNG039070 · TK1151

Extracellular0.052

Rank 5 · TkAUNG039070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00056Ldh_1_N2-125 aa

PF02866Ldh_1_C127-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG039070	`PF00056`	Ldh_1_N	2	125	6.5e-34	117.7
TkAUNG039070	`PF02866`	Ldh_1_C	127	290	1.8e-49	168.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZP06`	Arabidopsis thaliana	sp\|Q9ZP06\|MDHM1_ARATH Malate dehydrogenase 1, mitochondrial	81.800%	Swiss-Prot	High
`Q9LKA3`	Arabidopsis thaliana	sp\|Q9LKA3\|MDHM2_ARATH Malate dehydrogenase 2, mitochondrial	79.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card