TkAUNG037910 | RubberDandelionOmics

Gene overview

TkAUNG037910

Reference: TK1151 Chr: ChrUn Coordinates: 10325062-10327138 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1114 bp · TkAUNG037910|TK1151|cDNA

TGAAGATTTTATTTTAAGCTTTAAACGGTTGGACTGGAGATATTTTTTTAACCGCGGTTGGAAACCAAGCAGGTTAACCTGAGTACGTGGATCCTAGTGCCACTCATCCCAACTCCCAAATGTGACACTGAAATGTCAAAAATTGCATCTACCTGCAACCAAATCCACATTAATCTCAACAGAGCTCAACTCTCCTCTACCATGGCCGCCGTCACACTATCTCCGGCTACTCATCAGTGCTGTTCTAGCAAGAATAGAGT...

CDS

Download CDS FASTA

720 bp · TkAUNG037910|TK1151|CDS

ATGTCAAAAATTGCATCTACCTGCAACCAAATCCACATTAATCTCAACAGAGCTCAACTCTCCTCTACCATGGCCGCCGTCACACTATCTCCGGCTACTCATCAGTGCTGTTCTAGCAAGAATAGAGTGTTCTCACCTACCAAACGACTAACGGCGAAATCGGCTAGATTTGAAACGGCGGTTCACCAAAAGGGGATGAAGGTCACATGTCAGGCAGCAAGCATTGCCGCCGACGGTGTTTCTGATATGGAGAGAAGGAA...

Protein

Download Protein FASTA

239 aa · TkAUNG037910|TK1151|PROTEIN

MSKIASTCNQIHINLNRAQLSSTMAAVTLSPATHQCCSSKNRVFSPTKRLTAKSARFETAVHQKGMKVTCQAASIAADGVSDMERRKLMNLLLVGAIGLPVAGILAPYTARPSSSSWQDGIATTARDEFGNNIIASEWLNTHPPHDRTLTHGLKGDPTYIIVENNTTIAKYAINAVCTHLGCIVPWNTVQKKFICTCHGSQYDNYGKVIKGPSTKSLKLAHVDIDDGRVVFVPWIESDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG037910`
TK1151 ID	TkAUNG037910
OH-1004 ID	LXL04_016433
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.000
Protein coverage (%)	TK1151 89.958 / OH-1004 95.528 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG037910`
Location	ChrUn:10325062-10327138 (+)
Description	Similar to petC: Cytochrome b6-f complex iron-sulfur subunit, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016433` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009767 photosynthetic electron transport chain Biological Process GO:0005743 mitochondrial inner membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0003729 mRNA binding Molecular Function GO:0009496 plastoquinol--plastocyanin reductase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function
KEGG gene cross-reference	dosa:Os07g0556200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.956

Rank 1 · TkAUNG037910 · TK1151

Mitochondrion0.049

Rank 2 · TkAUNG037910 · TK1151

Nucleus0.013

Rank 3 · TkAUNG037910 · TK1151

Cytoplasm0.012

Rank 4 · TkAUNG037910 · TK1151

Cell membrane0.008

Rank 5 · TkAUNG037910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24884NPHP3_hel3-89 aa

PF25471TM_PetC78-109 aa

PF00355Rieske155-218 aa

PF15920WHAMM-JMY_N178-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG037910	`PF24884`	NPHP3_hel	3	89	0.11	13.3
TkAUNG037910	`PF25471`	TM_PetC	78	109	4e-13	49.6
TkAUNG037910	`PF00355`	Rieske	155	218	1.3e-10	41.8
TkAUNG037910	`PF15920`	WHAMM-JMY_N	178	199	0.016	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card