Gene Card
Gene overview
cDNA / CDS / Protein Sequences
978 bp · TkAUNG032340|TK1151|cDNA
TGCAGGGCACAAGAGGGCTTTTTGGTCTTTGCACTCGTTTCTTCTCCTTATCCTTCTCCTGTTCCCTCTTTCTTCTCCATCTCGGCATTCCGACCTCTTATCCTTCCCCTGTTTGCTCAGTCCCGTCGCATCCATCAGATTGATTCCCTCCGCTCTTCTTCCATGTCGTTGTTTGCTCCGTCCCGTCACATCCATCCTTTCACCCAATGCTTTATCCGAAATCGTCCAAAATTGGATAACAGTACCCGCGATTCAGTTGG...
978 bp · TkAUNG032340|TK1151|CDS
TGCAGGGCACAAGAGGGCTTTTTGGTCTTTGCACTCGTTTCTTCTCCTTATCCTTCTCCTGTTCCCTCTTTCTTCTCCATCTCGGCATTCCGACCTCTTATCCTTCCCCTGTTTGCTCAGTCCCGTCGCATCCATCAGATTGATTCCCTCCGCTCTTCTTCCATGTCGTTGTTTGCTCCGTCCCGTCACATCCATCCTTTCACCCAATGCTTTATCCGAAATCGTCCAAAATTGGATAACAGTACCCGCGATTCAGTTGG...
Protein
Download Protein FASTA325 aa · TkAUNG032340|TK1151|PROTEIN
CRAQEGFLVFALVSSPYPSPVPSFFSISAFRPLILPLFAQSRRIHQIDSLRSSSMSLFAPSRHIHPFTQCFIRNRPKLDNSTRDSVGFTVISVHTRPYLYRPKTQRHPSNSIKHKAQVIDRSPGRRTVRYQTLLADDGSPLEEVISVRRLRPPPPTVVARFHLGDMVDAWHNEGWLLLLQSDHPGLLCKLLCFLYLVLVVEQSKYGDGMAWFRGCLIGKGCFGRVYVANLKKPKSRYSSFPPILAVKSAEVSVSSSIQKE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG032340 |
|---|---|
| TK1151 ID | TkAUNG032340 |
| OH-1004 ID | LXL04_006392 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 83.700 |
| Protein coverage (%) | TK1151 96.000 / OH-1004 87.760Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG032340 |
|---|---|
| Location | ChrUn:8638669-8640295 (-) |
| Description | Similar to MAPKKK20: Mitogen-activated protein kinase kinase kinase 20 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000302 response to reactive oxygen species Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006970 response to osmotic stress Biological Process GO:0007165 signal transduction Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0010029 regulation of seed germination Biological Process GO:0010082 regulation of root meristem growth Biological Process GO:0046777 protein autophosphorylation Biological Process |
| KEGG gene cross-reference | ath:AT2G32510 ath:AT3G50310 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05641Agenet115-155 aaPF05641Agenet206-219 aaPF00069Pkinase216-311 aaPF07714PK_Tyr_Ser-Thr216-293 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG032340 | PF05641 | Agenet | 115 | 155 | 3.4e-06 | 28.1 |
| TkAUNG032340 | PF05641 | Agenet | 206 | 219 | 3.4e-06 | 28.1 |
| TkAUNG032340 | PF00069 | Pkinase | 216 | 311 | 0.01 | 16.0 |
| TkAUNG032340 | PF07714 | PK_Tyr_Ser-Thr | 216 | 293 | 0.032 | 14.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.