TkAUNG031180 | RubberDandelionOmics

Gene overview

TkAUNG031180

Reference: TK1151 Chr: ChrUn Coordinates: 8411659-8413778 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · TkAUNG031180|TK1151|cDNA

ATGGATGAAAATGCAGTCTGCACATCTGCAGAACTCATATTTGCACCAATTGATGACTCTTTTGCTGAAGAAGCTCCTTTATTGCTCTCTGGTTTTCGCATAACTCCTTTATTGATCTCATGTAACTCTAATTCTTTTTGTGATGTGAAGAAGATATTAGAAGACATCGGGGATGATACATTGAGGAATTTCCAACGGTCGTGTTTTGGTCATTTATTAGATATTAAGTCAAACGACAGACTGAATGGAATTGTCCTACA...

CDS

Download CDS FASTA

1095 bp · TkAUNG031180|TK1151|CDS

ATGGATGAAAATGCAGTCTGCACATCTGCAGAACTCATATTTGCACCAATTGATGACTCTTTTGCTGAAGAAGCTCCTTTATTGCTCTCTGGTTTTCGCATAACTCCTTTATTGATCTCATGTAACTCTAATTCTTTTTGTGATGTGAAGAAGATATTAGAAGACATCGGGGATGATACATTGAGGAATTTCCAACGGTCGTGTTTTGGTCATTTATTAGATATTAAGTCAAACGACAGACTGAATGGAATTGTCCTACA...

Protein

Download Protein FASTA

364 aa · TkAUNG031180|TK1151|PROTEIN

MDENAVCTSAELIFAPIDDSFAEEAPLLLSGFRITPLLISCNSNSFCDVKKILEDIGDDTLRNFQRSCFGHLLDIKSNDRLNGIVLHQIIARQVTFEGMDKNEAWFRIGEQFIRWSKMKFCLTMGLKFGTSEFDPNDVHDVIEDGVWNKYFEGRGVAVEDLWIDFKAHKFDQDPDVAVKVALIVITELVLFGHDERHCIRSWIWTLVEDRQKWDDFPWGKFTYLNTLNYLDKISSPTSPPKTNNEKTLIISLVFPWHYRY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG031180`
TK1151 ID	TkAUNG031180
OH-1004 ID	LXL04_032148
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.700
Protein coverage (%)	TK1151 10.165 / OH-1004 4.442 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG031180

Location ChrUn:8411659-8413778 (+)

Description Similar to ATHB-15: Homeobox-leucine zipper protein ATHB-15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52150`	Probable transcription factor involved in the regulation of meristem development to promote lateral organ formation.	Mutations in the microRNA complementarity site of the INCURVATA4 gene perturb meristem function and adaxialize lateral organs in arabidopsis.2006 · DOI: 10.1104/pp.106.077149
`At1g30490`	Probable transcription factor involved in the determination of adaxial-abaxial polarity in ovule primordium.	The Arabidopsis Athb-8, -9 and -14 genes are members of a small gene family coding for highly related HD-ZIP proteins.1998 · DOI: 10.1023/a:1006016319613

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZMN9`	Probable transcription factor.	No verified direct reference in this release
`Os12g0612700`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2XK30`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032148 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009855 determination of bilateral symmetry Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010014 meristem initiation Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

KEGG gene cross-reference

ath:AT1G52150

ath:AT4G32880

dosa:Os03g0640800

dosa:Os12g0612700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.739

Rank 1 · TkAUNG031180 · TK1151

Cytoplasm0.306

Rank 2 · TkAUNG031180 · TK1151

Cell membrane0.035

Rank 3 · TkAUNG031180 · TK1151

Mitochondrion0.029

Rank 4 · TkAUNG031180 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkAUNG031180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29561DUF856641-232 aa

PF09331DUF198599-225 aa

PF02902Peptidase_C48290-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG031180	`PF29561`	DUF8566	41	232	5.9e-06	26.9
TkAUNG031180	`PF09331`	DUF1985	99	225	4.4e-13	50.1
TkAUNG031180	`PF02902`	Peptidase_C48	290	346	0.0022	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU11`	Arabidopsis thaliana	sp\|Q9ZU11\|ATB15_ARATH Homeobox-leucine zipper protein ATHB-15	81.100%	Swiss-Prot	Low
`O04292`	Arabidopsis thaliana	sp\|O04292\|ATBH9_ARATH Homeobox-leucine zipper protein ATHB-9	59.100%	Swiss-Prot	Low
`A2ZMN9`	Oryza sativa subsp. indica	sp\|A2ZMN9\|HOX33_ORYSI Homeobox-leucine zipper protein HOX33	67.600%	Swiss-Prot	Low
`Q2QM96`	Oryza sativa subsp. japonica	sp\|Q2QM96\|HOX33_ORYSJ Homeobox-leucine zipper protein HOX33	67.600%	Swiss-Prot	Low
`A2XK30`	Oryza sativa subsp. indica	sp\|A2XK30\|HOX32_ORYSI Homeobox-leucine zipper protein HOX32	64.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card