TkAUNG027650 | RubberDandelionOmics

Gene overview

TkAUNG027650

Reference: TK1151 Chr: ChrUn Coordinates: 7399412-7404416 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1353 bp · TkAUNG027650|TK1151|cDNA

TTAGTTAATGAATATCTTCTGATGGATATAATCATTGCATTCTGTTATGACTTATCTTTATCTTGTCGGAAAACTGCAGGAGTACACAATGTCAGATTTGCAGGAATTCAAAAATGTCAGATTATCTATGCGAAGAGTTGATTGTTGAAATTTTTACAAGACTACCACCCAAATCTCTTCTACGATTTCGGTCACTCTCTAAATTGTTATGTAGTTGTATTTCTAGCCCTGTTTTCATACGCATGAACACTTTTCGGTCA...

CDS

Download CDS FASTA

1083 bp · TkAUNG027650|TK1151|CDS

ATGTCAGATTATCTATGCGAAGAGTTGATTGTTGAAATTTTTACAAGACTACCACCCAAATCTCTTCTACGATTTCGGTCACTCTCTAAATTGTTATGTAGTTGTATTTCTAGCCCTGTTTTCATACGCATGAACACTTTTCGGTCACCACAAAAAATCATCCTCACACGTCTAAAAAGAAAAAAAAATAAAAAAGTACAAGAAGTTCAAACTTTACATGGAGAAGACGAATTTCCATTGTGTTTGTGTTCTAAACGTGG...

Protein

Download Protein FASTA

360 aa · TkAUNG027650|TK1151|PROTEIN

MSDYLCEELIVEIFTRLPPKSLLRFRSLSKLLCSCISSPVFIRMNTFRSPQKIILTRLKRKKNKKVQEVQTLHGEDEFPLCLCSKRGYIGIRTKVPRFRCSTYFKTVGSCNGIFCVITENCLSLWNPSIRRKVSVPKYPQRSELVSKNIEFGFGFDPISDDYKIVGVSYPDDRSFVFALKMGTWCEIASPKSHISSIPEPFLFDGVLHWYVFKNISSQEILTFDLRTHVFGMIPLPEPIYDWFITNITTIQGSLALISYH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG027650`
TK1151 ID	TkAUNG027650
OH-1004 ID	LXL04_039922
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.700
Protein coverage (%)	TK1151 100.000 / OH-1004 95.763 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG027650

Location ChrUn:7399412-7404416 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19930`	F-box/kelch-repeat protein At4g19930.	No verified direct reference in this release
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release
`At4g19940`	F-box protein At4g19940.	No verified direct reference in this release
`At3g52320`	Putative F-box protein At3g52320.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039922 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G40910

ath:AT3G06240

ath:AT3G16210

ath:AT4G19930

ath:AT4G21240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.598

Rank 1 · TkAUNG027650 · TK1151

Nucleus0.438

Rank 2 · TkAUNG027650 · TK1151

Cell membrane0.097

Rank 3 · TkAUNG027650 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkAUNG027650 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkAUNG027650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-41 aa

PF12937F-box-like7-39 aa

PF08268FBA_3102-275 aa

PF24750b-prop_At3g26010-like106-279 aa

PF00646F-box325-333 aa

PF12937F-box-like325-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG027650	`PF00646`	F-box	5	41	4.5e-07	30.2
TkAUNG027650	`PF12937`	F-box-like	7	39	0.00084	19.8
TkAUNG027650	`PF08268`	FBA_3	102	275	8.3e-22	78.3
TkAUNG027650	`PF24750`	b-prop_At3g26010-like	106	279	0.00034	20.6
TkAUNG027650	`PF00646`	F-box	325	333	4.5e-07	30.2
TkAUNG027650	`PF12937`	F-box-like	325	333	0.00084	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49420`	Arabidopsis thaliana	sp\|O49420\|FBK86_ARATH F-box/kelch-repeat protein At4g19930	26.500%	Swiss-Prot	Low
`Q9SXA0`	Arabidopsis thaliana	sp\|Q9SXA0\|FB42_ARATH Putative F-box protein At1g47730	25.900%	Swiss-Prot	Low
`O49421`	Arabidopsis thaliana	sp\|O49421\|FB238_ARATH F-box protein At4g19940	25.200%	Swiss-Prot	Low
`Q9FT50`	Arabidopsis thaliana	sp\|Q9FT50\|FB202_ARATH Putative F-box protein At3g52320	26.600%	Swiss-Prot	Low
`Q9C6J3`	Arabidopsis thaliana	sp\|Q9C6J3\|FB52_ARATH Putative F-box protein At1g50870	25.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card