TkAUNG026520 | RubberDandelionOmics

Gene overview

TkAUNG026520

Reference: TK1151 Chr: ChrUn Coordinates: 7109494-7110930 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · TkAUNG026520|TK1151|cDNA

AAAAGATCCAAAACCTCATCTCAGAATTCAGGTTGCCTCAACACAAGCCACAAACTCATCGACCCCACACCCTTCACCCTCCCCTTATGTTTCCCCCCTCCCCTTCCCCTAAGGCAGCCACACACGACCACTTACTCTTCTCAAGAAAATGGCTACACAGGCTTTGGTCTCATCGTCTTCCCTCACCTCCTCCGTCGAGTCCGCTAGGCAGATCTTAGCACAAAGGCCCGTTCTTCACTCTTCAAGAAAGGTCAACTTTG...

CDS

Download CDS FASTA

819 bp · TkAUNG026520|TK1151|CDS

ATGGCTACACAGGCTTTGGTCTCATCGTCTTCCCTCACCTCCTCCGTCGAGTCCGCTAGGCAGATCTTAGCACAAAGGCCCGTTCTTCACTCTTCAAGAAAGGTCAACTTTGTCGTCAAAGCCTCTTCCAGCCCTCCCGTTAAGCAAGGAGACAGACAACTATGGTTTGCATCCAAGCAATCTCTCTCTTACCTCGATGGAAGTCTCCCCGGCGACTTTGGATTCGACCCACTTGGTCTCTCGGACCCAGAAGGAACCGG...

Protein

Download Protein FASTA

272 aa · TkAUNG026520|TK1151|PROTEIN

MATQALVSSSSLTSSVESARQILAQRPVLHSSRKVNFVVKASSSPPVKQGDRQLWFASKQSLSYLDGSLPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEVFGKLGLIPPETALPWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKGFSGSGDPAYPGGPFFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPFQNLLDHLADP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG026520`
TK1151 ID	TkAUNG026520
OH-1004 ID	LXL04_037899
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG026520

Location ChrUn:7109494-7110930 (+)

Description Similar to CAB8: Chlorophyll a-b binding protein 8, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61520`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated, here photosystem I.	No verified direct reference in this release
`At1g45474`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	Lhca5--an LHC-type protein associated with photosystem I.2004 · DOI: 10.1023/b:plan.0000040813.05224.94 Efficient operation of NAD(P)H dehydrogenase requires supercomplex formation with photosystem I via minor LHCI in Arabidopsis.2009 · DOI: 10.1105/tpc.109.068791 Supercomplex formation with photosystem I is required for the stabilization of the chloroplast NADH dehydrogenase-like complex in Arabidopsis.2011 · DOI: 10.1104/pp.110.171264
`At3g47470`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037899 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009645 response to low light intensity stimulus Biological Process

GO:0009765 photosynthesis, light harvesting Biological Process

GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009522 photosystem I Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45474

ath:AT1G61520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.988

Rank 1 · TkAUNG026520 · TK1151

Mitochondrion0.021

Rank 2 · TkAUNG026520 · TK1151

Cytoplasm0.011

Rank 3 · TkAUNG026520 · TK1151

Nucleus0.008

Rank 4 · TkAUNG026520 · TK1151

Peroxisome0.008

Rank 5 · TkAUNG026520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504Chloroa_b-bind63-242 aa

PF31213HliA95-125 aa

PF31213HliA224-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG026520	`PF00504`	Chloroa_b-bind	63	242	1.2e-46	159.8
TkAUNG026520	`PF31213`	HliA	95	125	1.5e-07	32.0
TkAUNG026520	`PF31213`	HliA	224	248	1.5e-07	32.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY97`	Arabidopsis thaliana	sp\|Q9SY97\|LHCA3_ARATH Photosystem I chlorophyll a/b-binding protein 3-1, chloroplastic	86.100%	Swiss-Prot	High
`Q9C639`	Arabidopsis thaliana	sp\|Q9C639\|LHCA5_ARATH Photosystem I chlorophyll a/b-binding protein 5, chloroplastic	42.500%	Swiss-Prot	Medium
`P27521`	Arabidopsis thaliana	sp\|P27521\|CA4_ARATH Chlorophyll a-b binding protein 4, chloroplastic	46.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card