TkAUNG025220 | RubberDandelionOmics

Gene overview

TkAUNG025220

Reference: TK1151 Chr: ChrUn Coordinates: 6755012-6759939 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2428 bp · TkAUNG025220|TK1151|cDNA

TTGGTCGCCACACACTTCAATTAAATAAACTCTTTAATTCGAAAAAAGTCAAAAACAACTACACACAAAGGCTCCACGTACGGTCTCACAGTTCGCTGCTCTAATGGCGACGCCGAAGCAGGCGGAGAGCGGCGGCGAATGGGAAAGCCAGTCCAGGTTATACGAGGCCTACAACGACCTGCACGGACTAGCACAAGAGTTCGAGACCCCGTTCGATGCACCAGCGGTGCTAGTCGTCGGACACCAAACAGATGGTAAGA...

CDS

Download CDS FASTA

2166 bp · TkAUNG025220|TK1151|CDS

ATGGCGACGCCGAAGCAGGCGGAGAGCGGCGGCGAATGGGAAAGCCAGTCCAGGTTATACGAGGCCTACAACGACCTGCACGGACTAGCACAAGAGTTCGAGACCCCGTTCGATGCACCAGCGGTGCTAGTCGTCGGACACCAAACAGATGGTAAGAGCGCCCTCGTGGAAGCCCTAATGGGATTCCAATTCAACCACGTTGGCGGTGGCACTAAGACCCGCCGTCCTATTACTCTACACATGAGGTTCAACCCTGAATG...

Protein

Download Protein FASTA

721 aa · TkAUNG025220|TK1151|PROTEIN

MATPKQAESGGEWESQSRLYEAYNDLHGLAQEFETPFDAPAVLVVGHQTDGKSALVEALMGFQFNHVGGGTKTRRPITLHMRFNPECDSPLCHLISDSDSCVPQEKSLREIQEYIEAENMRLEHETCQFSSKEIIIRVEYKYCPNLTIIDTPGLIAPAPGRKNRALQAQSRAVESLVRAKMQHKEFIVLCLEDCNDWSNATTRRVVMQIDPELSRLWLCQLSLIPKIPQFARASDVEVFLSPPASVLDGFMLGDSPFFTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG025220`
TK1151 ID	TkAUNG025220
OH-1004 ID	LXL04_038701
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG025220

Location ChrUn:6755012-6759939 (-)

Description Similar to ARC5: Dynamin-like protein ARC5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19720`	Mechanochemical GTPase component of both plastid and peroxisome division machinery.	The distinctive roles of five different ARC genes in the chloroplast division process in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00500.x A Genetic Analysis of Chloroplast Division and Expansion in Arabidopsis thaliana.1994 · DOI: 10.1104/pp.104.1.201 ARC5, a cytosolic dynamin-like protein from plants, is part of the chloroplast division machinery.2003 · DOI: 10.1073/pnas.0530206100 Effects of arc3, arc5 and arc6 mutations on plastid morphology and stromule formation in green and nongreen tissues of Arabidopsis thaliana.2008 · DOI: 10.1111/j.1751-1097.2008.00437.x The Arabidopsis chloroplast division protein DYNAMIN-RELATED PROTEIN5B also mediates peroxisome division.2010 · DOI: 10.1105/tpc.109.071324 The Arabidopsis arc5 and arc6 mutations differentially affect plastid morphology in pavement and guard cells in the leaf epidermis.2018 · DOI: 10.1371/journal.pone.0192380 PDV1 and PDV2 Differentially Affect Remodeling and Assembly of the Chloroplast DRP5B Ring.2020 · DOI: 10.1104/pp.19.01490 Characterization of chloroplast division using the Arabidopsis mutant arc5.1996 · DOI: 10.1104/pp.112.1.149
`At1g53140`	Probable microtubule-associated force-producing protein that is targeted to the forming cell plate during cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038701 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0030835 negative regulation of actin filament depolymerization Biological Process

GO:0061952 midbody abscission Biological Process

GO:1905345 protein localization to cleavage furrow Biological Process

GO:0001891 phagocytic cup Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G53140

ath:AT3G19720

ddi:DDB_G0268592

ddi:DDB_G0271628

ddi:DDB_G0285931

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.594

Rank 1 · TkAUNG025220 · TK1151

Nucleus0.296

Rank 2 · TkAUNG025220 · TK1151

Mitochondrion0.196

Rank 3 · TkAUNG025220 · TK1151

Cell membrane0.085

Rank 4 · TkAUNG025220 · TK1151

Peroxisome0.064

Rank 5 · TkAUNG025220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191AAA_1629-201 aa

PF13175AAA_1531-185 aa

PF13476AAA_2333-65 aa

PF00350Dynamin_N42-215 aa

PF01926MMR_HSR142-173 aa

PF13476AAA_23293-359 aa

PF13175AAA_15345-359 aa

PF13191AAA_16570-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG025220	`PF13191`	AAA_16	29	201	0.017	16.4
TkAUNG025220	`PF13175`	AAA_15	31	185	0.022	15.0
TkAUNG025220	`PF13476`	AAA_23	33	65	0.15	13.4
TkAUNG025220	`PF00350`	Dynamin_N	42	215	2.9e-30	106.2
TkAUNG025220	`PF01926`	MMR_HSR1	42	173	0.003	18.4
TkAUNG025220	`PF13476`	AAA_23	293	359	0.15	13.4
TkAUNG025220	`PF13175`	AAA_15	345	359	0.022	15.0
TkAUNG025220	`PF13191`	AAA_16	570	615	0.017	16.4
TkAUNG025220	`PF13476`	AAA_23	646	715	0.15	13.4
TkAUNG025220	`PF00350`	Dynamin_N	671	703	2.9e-30	106.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84N64`	Arabidopsis thaliana	sp\|Q84N64\|ARC5_ARATH Dynamin-like protein ARC5	76.300%	Swiss-Prot	High
`F4HPR5`	Arabidopsis thaliana	sp\|F4HPR5\|DRP5A_ARATH Dynamin-related protein 5A	28.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card