TkAUNG023990 | RubberDandelionOmics

Gene overview

TkAUNG023990

Reference: TK1151 Chr: ChrUn Coordinates: 6436827-6438955 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · TkAUNG023990|TK1151|cDNA

TGATATCATGGAGATCCGTATGCCTGATTCCCTATCCATCTCCTTCTATTTTTGATGATTTATAACGTATATATTATCCGCAATACTTGGTGAGTGCAGACTGGTAAGCTGCAGCAGACGATTGGTGGTTGTATAGAAAAGACAGGGACAACGCTTCATTCCGGAAACCAGTCGACTGTCAGAATTTGGCCTGAGCTCGCCGGAAAAGGGAGGTACTTCGATTTTAATTCCCGTTTAATCCCCGCATCAATTGATTTTGC...

CDS

Download CDS FASTA

945 bp · TkAUNG023990|TK1151|CDS

ATGACACTTCGTGGCGCCGCCGTTGCAGCTTTCAAGTCCTCTGCTCTGATATCATGGAGATCCACTGGTAAGCTGCAGCAGACGATTGGTGGTTGTATAGAAAAGACAGGGACAACGCTTCATTCCGGAAACCAGTCGACTGTCAGAATTTGGCCTGAGCTCGCCGGAAAAGGGAGGTACTTCGATTTTAATTCCCGTTTAATCCCCGCATCAATTGATTTTGCTGAAGAATCGCCACTCTGTACCACGCTTCGTAAAGA...

Protein

Download Protein FASTA

314 aa · TkAUNG023990|TK1151|PROTEIN

MTLRGAAVAAFKSSALISWRSTGKLQQTIGGCIEKTGTTLHSGNQSTVRIWPELAGKGRYFDFNSRLIPASIDFAEESPLCTTLRKDGHSVGTVEHLLSALEGTGVDNCRIEVINSDNNDPSAEIPIFDGSAREWVEAIEQVGVTAAMDFNGKSCDKLAPYLTQPVHVSKGDSVISAFPSKQISISYGINFPQVPALSLQWFTSVFSTDSFYSKQIAPSRTFCIYEEVEKMRSAGLIKGGSLENAVVFSISKGLMNPPLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG023990`
TK1151 ID	TkAUNG023990
OH-1004 ID	LXL04_025101
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG023990

Location ChrUn:6436827-6438955 (-)

Description Similar to LPXC5: Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 5, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24793`	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release
`At1g24880`	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release
`At1g25054`	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release
`At1g25145`	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release
`At1g25210`	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025101 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009245 lipid A biosynthetic process Biological Process

GO:2001289 lipid X metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0103117 UDP-3-O-acyl-N-acetylglucosamine deacetylase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24793

ath:AT1G25054

ath:AT1G25145

ath:AT1G25210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.618

Rank 1 · TkAUNG023990 · TK1151

Nucleus0.202

Rank 2 · TkAUNG023990 · TK1151

Cytoplasm0.163

Rank 3 · TkAUNG023990 · TK1151

Plastid0.080

Rank 4 · TkAUNG023990 · TK1151

Cell membrane0.017

Rank 5 · TkAUNG023990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03331LpxC26-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG023990	`PF03331`	LpxC	26	310	1e-77	262.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IAT8`	Arabidopsis thaliana	sp\|F4IAT8\|LPXC1_ARATH Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 1, mitochondrial	57.000%	Swiss-Prot	High
`P0DKB7`	Arabidopsis thaliana	sp\|P0DKB7\|LPXC2_ARATH Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 2, mitochondrial	57.000%	Swiss-Prot	High
`P0DKB8`	Arabidopsis thaliana	sp\|P0DKB8\|LPXC3_ARATH Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 3, mitochondrial	57.000%	Swiss-Prot	High
`P0DKB9`	Arabidopsis thaliana	sp\|P0DKB9\|LPXC4_ARATH Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 4, mitochondrial	57.000%	Swiss-Prot	High
`F4IAW1`	Arabidopsis thaliana	sp\|F4IAW1\|LPXC5_ARATH Probable UDP-3-O-acyl-N-acetylglucosamine deacetylase 5, mitochondrial	57.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card