TkAUNG023610 | RubberDandelionOmics

Gene overview

TkAUNG023610

Reference: TK1151 Chr: ChrUn Coordinates: 6373539-6374147 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkAUNG023610|TK1151|cDNA

ATGGGTTTGAAGAATTTGTTTAATCGGAAGAAGAAAAGCGGCAAGGACAAGTCTCCGGTTGCATCGCGTACGAGCTCCTTCAACTCTCGCGAGCGGATCGAAGAGGAGTTGGAACAAGTGTTCAAGAAGTTCGACGTCAATGGGGATGGGAAGATCTCGTGGTCTGAGTTGGGATCGATAATGGGCAGCCTCGGCCACCAGCCTAACGAGGAGGAACTAAAGAACATGATCAAAGAGGTGGATGCCGACGGTGATGGGTT...

CDS

Download CDS FASTA

573 bp · TkAUNG023610|TK1151|CDS

ATGGGTTTGAAGAATTTGTTTAATCGGAAGAAGAAAAGCGGCAAGGACAAGTCTCCGGTTGCATCGCGTACGAGCTCCTTCAACTCTCGCGAGCGGATCGAAGAGGAGTTGGAACAAGTGTTCAAGAAGTTCGACGTCAATGGGGATGGGAAGATCTCGTGGTCTGAGTTGGGATCGATAATGGGCAGCCTCGGCCACCAGCCTAACGAGGAGGAACTAAAGAACATGATCAAAGAGGTGGATGCCGACGGTGATGGGTT...

Protein

Download Protein FASTA

190 aa · TkAUNG023610|TK1151|PROTEIN

MGLKNLFNRKKKSGKDKSPVASRTSSFNSRERIEEELEQVFKKFDVNGDGKISWSELGSIMGSLGHQPNEEELKNMIKEVDADGDGFINLQEFVELNTKDIDSAEVLENLKDAFSVFDIDKNGSISAEELHNVLESLGEDCSIAECQKMIAGVDVNGDGMISFDEFKVMMMTGTRFDSIGSKRHVEVKDN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG023610`
TK1151 ID	TkAUNG023610
OH-1004 ID	LXL04_025097
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG023610

Location ChrUn:6373539-6374147 (-)

Description Similar to CML25: Probable calcium-binding protein CML25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24620`	Potential calcium sensor.	No verified direct reference in this release
`At1g18210`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0223000`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025097 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048767 root hair elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G24620

dosa:Os01g0949500

dosa:Os05g0380900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.383

Rank 1 · TkAUNG023610 · TK1151

Cell membrane0.284

Rank 2 · TkAUNG023610 · TK1151

Nucleus0.225

Rank 3 · TkAUNG023610 · TK1151

Endoplasmic reticulum0.107

Rank 4 · TkAUNG023610 · TK1151

Lysosome / Vacuole0.086

Rank 5 · TkAUNG023610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10591SPARC_Ca_bdg16-94 aa

PF03874RNA_pol_Rpb416-43 aa

PF05042Caleosin21-61 aa

PF23564EF-hand_FSTL124-61 aa

PF21008AIF-127-96 aa

PF27343MJ020728-54 aa

PF30624EF_SSP12030-56 aa

PF31181Pept_C14_Metacaspase33-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG023610	`PF10591`	SPARC_Ca_bdg	16	94	2.3e-10	41.5
TkAUNG023610	`PF03874`	RNA_pol_Rpb4	16	43	0.065	14.2
TkAUNG023610	`PF05042`	Caleosin	21	61	0.0023	18.6
TkAUNG023610	`PF23564`	EF-hand_FSTL1	24	61	1e-10	42.8
TkAUNG023610	`PF21008`	AIF-1	27	96	5.8e-15	56.5
TkAUNG023610	`PF27343`	MJ0207	28	54	0.22	12.4
TkAUNG023610	`PF30624`	EF_SSP120	30	56	1.4e-06	29.5
TkAUNG023610	`PF31181`	Pept_C14_Metacaspase	33	64	0.17	13.3
TkAUNG023610	`PF13499`	EF-hand_7	34	96	9.9e-32	109.8
TkAUNG023610	`PF13833`	EF-hand_8	34	56	3.4e-21	75.4
TkAUNG023610	`PF12763`	EH	34	56	0.0028	18.3
TkAUNG023610	`PF02563`	Poly_export	35	60	0.0053	17.6
TkAUNG023610	`PF25578`	EF-hand_STIM1	35	56	0.051	14.4
TkAUNG023610	`PF00036`	EF-hand_1	36	63	6.9e-35	116.7
TkAUNG023610	`PF13405`	EF-hand_6	36	65	4.6e-28	94.9
TkAUNG023610	`PF24548`	EF_EFCAB10_C	36	79	1.1e-06	28.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYK2`	Arabidopsis thaliana	sp\|Q9FYK2\|CML25_ARATH Probable calcium-binding protein CML25	62.500%	Swiss-Prot	High
`Q9LE22`	Arabidopsis thaliana	sp\|Q9LE22\|CML27_ARATH Probable calcium-binding protein CML27	41.500%	Swiss-Prot	Medium
`Q0DJV6`	Oryza sativa subsp. japonica	sp\|Q0DJV6\|CML18_ORYSJ Probable calcium-binding protein CML18	41.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card