TkAUNG020090 | RubberDandelionOmics

Gene overview

TkAUNG020090

Reference: TK1151 Chr: ChrUn Coordinates: 5380179-5384345 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1175 bp · TkAUNG020090|TK1151|cDNA

GTTCCAGTAGTCTGCCGGAAACGGTTTCCTTCCTTCATGCTTCATTCATGTAGCACAGTAGCAGCAGCAAGCCGACTAAATTCCGTTCACTCAACTACTAGATTCCCTCTTCAGATGGCAGGTGGTCGTAAGTTGTTAGCAGCAGCGGTGGCGGTCGGAATAGTTTCGGCAGTGTTGAAGGTCAAAGGACCATCGATATGGGACAAAGACGCGGTCGTCGATTTCTTCAGAAACATGTCTGATCGATTGGGTAATTGGGC...

CDS

Download CDS FASTA

1497 bp · TkAUNG020090|TK1151|CDS

ATGAAAGAATTACCTTTGAATTTGCTGAGGGGATGGGAGAAGACGAAGGAAGCAATATTTTTCGGATTCGCCATTACCGCCCTAAATTATGAGAAAGCGAGTCTCAAGCCTTTCAACTACTTGGATTTACACTGTAAGAATTATGAGTTCAAACTTCAAAGTGACATGATAATTGATTCGGTGGTGCATCTACTTGGTGCTGCTGAGGAAAAAAGAAATTACAAAATCATCAGGGATGATATTGAGGATGGCGACGAGGA...

Protein

Download Protein FASTA

498 aa · TkAUNG020090|TK1151|PROTEIN

MKELPLNLLRGWEKTKEAIFFGFAITALNYEKASLKPFNYLDLHCKNYEFKLQSDMIIDSVVHLLGAAEEKRNYKIIRDDIEDGDEDEGEGEDLFNDNYIEDYRGMEEHDQYESVGLDDSLEDERDLDQIMADRLCHQDFIRLYNLLLNDKLINEYSLKQLGHSIGLLVPVVCRKRFPSFMLHSCSTVAAASRLNSVHSTTRFPLQMAGGRKLLAAAVAVGIVSAVLKVKGPSIWDKDAVVDFFRNMSDRLGNWAIPVYV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG020090`
TK1151 ID	TkAUNG020090
OH-1004 ID	LXL04_004597
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 13.855 / OH-1004 16.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG020090

Location ChrUn:5380179-5384345 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44900`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	The Arabidopsis MCM2 gene is essential to embryo development and its over-expression alters root meristem function.2009 · DOI: 10.1111/j.1469-8137.2009.02961.x Arabidopsis thaliana MCM2 plays role(s) in mungbean yellow mosaic India virus (MYMIV) DNA replication.2013 · DOI: 10.1007/s00705-012-1563-9

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BKI8`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`Os11g0484300`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	Identification and characterization of a rice MCM2 homologue required for DNA replication.2008 · DOI: 10.5483/bmbrep.2008.41.8.581

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004597 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.474

Rank 1 · TkAUNG020090 · TK1151

Nucleus0.153

Rank 2 · TkAUNG020090 · TK1151

Golgi apparatus0.135

Rank 3 · TkAUNG020090 · TK1151

Cytoplasm0.107

Rank 4 · TkAUNG020090 · TK1151

Plastid0.104

Rank 5 · TkAUNG020090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12619MCM2_N76-134 aa

PF09335VTT_dom272-314 aa

PF09335VTT_dom363-444 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG020090	`PF12619`	MCM2_N	76	134	9.7e-08	33.2
TkAUNG020090	`PF09335`	VTT_dom	272	314	2.3e-18	67.6
TkAUNG020090	`PF09335`	VTT_dom	363	444	2.3e-18	67.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPD9`	Arabidopsis thaliana	sp\|Q9LPD9\|MCM2_ARATH DNA replication licensing factor MCM2	68.200%	Swiss-Prot	Low
`B8BKI8`	Oryza sativa subsp. indica	sp\|B8BKI8\|MCM2_ORYSI DNA replication licensing factor MCM2	80.000%	Swiss-Prot	Low
`Q2R482`	Oryza sativa subsp. japonica	sp\|Q2R482\|MCM2_ORYSJ DNA replication licensing factor MCM2	80.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card