TkAUNG018090 | RubberDandelionOmics

Gene overview

TkAUNG018090

Reference: TK1151 Chr: ChrUn Coordinates: 4813185-4813778 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · TkAUNG018090|TK1151|cDNA

ATGGGTGTGTTGCTTTTATTTCTTGCTTTTATTTGGGGGTTTGCAGAAGAAGAGGATTCAAGCCCAGATGATGTTAACATAGGAGCCATATTTTCATTCAAAACCATCAATGGGAAAGTATCAAAGATTGGGATGGAAGCTGCTGTTGAGGATGTCAATTCTGATCCTACAATTCTTGGAGGGAGAAAATTGCATCTCTCCACACATGATTCTAATTTCAGTGGCTTTCTCAGCATTATTGGAGGATTACAGTATATGGA...

CDS

Download CDS FASTA

498 bp · TkAUNG018090|TK1151|CDS

ATGGGTGTGTTGCTTTTATTTCTTGCTTTTATTTGGGGGTTTGCAGAAGAAGAGGATTCAAGCCCAGATGATGTTAACATAGGAGCCATATTTTCATTCAAAACCATCAATGGGAAAGTATCAAAGATTGGGATGGAAGCTGCTGTTGAGGATGTCAATTCTGATCCTACAATTCTTGGAGGGAGAAAATTGCATCTCTCCACACATGATTCTAATTTCAGTGGCTTTCTCAGCATTATTGGAGGATTACAGTATATGGA...

Protein

Download Protein FASTA

165 aa · TkAUNG018090|TK1151|PROTEIN

MGVLLLFLAFIWGFAEEEDSSPDDVNIGAIFSFKTINGKVSKIGMEAAVEDVNSDPTILGGRKLHLSTHDSNFSGFLSIIGGLQYMETNTVAIIGPQTSGMAHILSHLANELHIPMMSFTALDPTLSSLQYPYFVQTAPNDLFQMTAIADMVSHFGYREVCGCLH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG018090`
TK1151 ID	TkAUNG018090
OH-1004 ID	LXL04_019404
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.100
Protein coverage (%)	TK1151 94.545 / OH-1004 16.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG018090

Location ChrUn:4813185-4813778 (-)

Description Similar to GLR3.6: Glutamate receptor 3.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35290`	Glutamate-gated receptor that probably acts as a non-selective cation channel (Probable).	Overexpression of the AtGluR2 gene encoding an Arabidopsis homolog of mammalian glutamate receptors impairs calcium utilization and sensitivity to ionic stress in transgenic plants.2001 · DOI: 10.1093/pcp/pce008 Interacting glutamate receptor-like proteins in Phloem regulate lateral root initiation in Arabidopsis.2013 · DOI: 10.1105/tpc.113.110668
`At2g17260`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	De-regulated expression of the plant glutamate receptor homolog AtGLR3.1 impairs long-term Ca2+-programmed stomatal closure.2009 · DOI: 10.1111/j.1365-313x.2009.03789.x
`At2g32390`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At3g51480`	Glutamate-gated receptor that probably acts as a non- selective cation channel.	GLUTAMATE RECEPTOR-LIKE genes mediate leaf-to-leaf wound signalling.2013 · DOI: 10.1038/nature12478

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0585200`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	A rice glutamate receptor-like gene is critical for the division and survival of individual cells in the root apical meristem.2006 · DOI: 10.1105/tpc.105.037713

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019404 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006883 intracellular sodium ion homeostasis Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009630 gravitropism Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G05200

ath:AT1G42540

ath:AT3G51480

ath:AT4G35290

osa:124544569

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.369

Rank 1 · TkAUNG018090 · TK1151

Extracellular0.280

Rank 2 · TkAUNG018090 · TK1151

Cytoplasm0.142

Rank 3 · TkAUNG018090 · TK1151

Lysosome / Vacuole0.126

Rank 4 · TkAUNG018090 · TK1151

Endoplasmic reticulum0.103

Rank 5 · TkAUNG018090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13458Peripla_BP_636-161 aa

PF01094ANF_receptor44-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG018090	`PF13458`	Peripla_BP_6	36	161	4.2e-08	33.9
TkAUNG018090	`PF01094`	ANF_receptor	44	160	3e-33	116.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YT1`	Arabidopsis thaliana	sp\|Q93YT1\|GLR32_ARATH Glutamate receptor 3.2	60.000%	Swiss-Prot	High
`Q7XJL2`	Arabidopsis thaliana	sp\|Q7XJL2\|GLR31_ARATH Glutamate receptor 3.1	58.000%	Swiss-Prot	High
`Q9SW97`	Arabidopsis thaliana	sp\|Q9SW97\|GLR35_ARATH Glutamate receptor 3.5	49.400%	Swiss-Prot	Medium
`Q84W41`	Arabidopsis thaliana	sp\|Q84W41\|GLR36_ARATH Glutamate receptor 3.6	52.000%	Swiss-Prot	High
`Q7XP59`	Oryza sativa subsp. japonica	sp\|Q7XP59\|GLR31_ORYSJ Glutamate receptor 3.1	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card