TkAUNG016790 | RubberDandelionOmics

Gene overview

TkAUNG016790

Reference: TK1151 Chr: ChrUn Coordinates: 4514890-4516817 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · TkAUNG016790|TK1151|cDNA

GATAAACCCTAAACCTTCAACGGCAACTTCACCTATATATAAGTCTTTCAAACCGCTCCTCTTCCTCATTCCGCCTTTTCTCGTCAATTCTTGCAAACTATATTCTCTCACCCTCTTAATCGAATCCTAGCAGCAATGGAATTTTGGGGTGTTGAGGTTAAACCTAATGAAAGCCTTAAGGTCACAGTCGAGGATTTCAAGCTCCTACACATCTCTCAGGTTGCATTGGGAGAGATGAAGAATGGGAAGAAGGTGGACAA...

CDS

Download CDS FASTA

471 bp · TkAUNG016790|TK1151|CDS

ATGGATGGAAAGATGGCAGCGTCTACTTCTGTGGATACATTGCAGATAACCCAGTCGATTGGATTCACGGATGATGATTATGAATTTGATTCTTCTGATGAAGAAGAAGCAATGAACCTTGCTGCCAATGGTCCAATTCAAGGTAAGCCAAAGGCATCTATCAAGGATGTAACCGAAGAAGATGACTCTGAAGACGATGAAGATGATTCTGATGATGAAATGGCTGACTCAGATGATGAAGACGACTCTGAAGAAGAAGA...

Protein

Download Protein FASTA

156 aa · TkAUNG016790|TK1151|PROTEIN

MDGKMAASTSVDTLQITQSIGFTDDDYEFDSSDEEEAMNLAANGPIQGKPKASIKDVTEEDDSEDDEDDSDDEMADSDDEDDSEEEEEKVEVKPVKKPVQAAKRPAESAQKTPVPAKKAKSNTPQKTDGKKGGHTATPHPHSKPSFKKGKKSGNRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG016790`
TK1151 ID	TkAUNG016790
OH-1004 ID	LXL04_009348
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.400
Protein coverage (%)	TK1151 85.256 / OH-1004 54.400 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG016790`
Location	ChrUn:4514890-4516817 (-)
Description	Similar to HDT1: Histone deacetylase HDT1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009348` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009294 DNA-mediated transformation Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009944 polarity specification of adaxial/abaxial axis Biological Process GO:0010162 seed dormancy process Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048364 root development Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT3G44750 ath:AT5G03740 gmx:547649 zma:542636 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkAUNG016790 · TK1151

Cytoplasm0.204

Rank 2 · TkAUNG016790 · TK1151

Extracellular0.034

Rank 3 · TkAUNG016790 · TK1151

Cell membrane0.028

Rank 4 · TkAUNG016790 · TK1151

Mitochondrion0.024

Rank 5 · TkAUNG016790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05327RRN312-97 aa

PF05764YL124-140 aa

PF04147Nop1424-126 aa

PF06524NOA3624-88 aa

PF30130VID28_C24-99 aa

PF30856ARM_UBR_1_2_324-127 aa

PF05793TFIIF_alpha30-143 aa

PF02724CDC4546-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG016790	`PF05327`	RRN3	12	97	9.2	5.4
TkAUNG016790	`PF05764`	YL1	24	140	0.00061	20.7
TkAUNG016790	`PF04147`	Nop14	24	126	0.081	11.9
TkAUNG016790	`PF06524`	NOA36	24	88	0.15	12.1
TkAUNG016790	`PF30130`	VID28_C	24	99	2.1	7.8
TkAUNG016790	`PF30856`	ARM_UBR_1_2_3	24	127	5.0	5.9
TkAUNG016790	`PF05793`	TFIIF_alpha	30	143	1.7	7.9
TkAUNG016790	`PF02724`	CDC45	46	130	0.048	12.6
TkAUNG016790	`PF01056`	Myc_N	47	120	0.029	14.8
TkAUNG016790	`PF30807`	HEAT_UBR5_2nd	50	139	0.86	8.1
TkAUNG016790	`PF23798`	Beta-prop_SPT8	53	99	6.0	6.3
TkAUNG016790	`PF26708`	C2orf42_C	53	127	6.1	6.9
TkAUNG016790	`PF04931`	DNA_pol_phi	56	91	0.42	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card