TkAUNG016760 | RubberDandelionOmics

Gene overview

TkAUNG016760

Reference: TK1151 Chr: ChrUn Coordinates: 4502983-4506314 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · TkAUNG016760|TK1151|cDNA

GTTGATGTGTATCTTTCGAATGGAGTATGCGCTAGAGCTGCTGTTCCTAGTGGTGCATCCACTGGGATCTATGAAGCTCTCGAATTAAGAGATGGAGGATCGGACTACCTTGGAAAGGGTGTCTCAAAGGCCGTTGGCAACGTCAACAATACCATTGGACCTGCCCTCATTGGAAAGGACCCTACAGATCAGACTGGTATTGATAATTTCATGGTTCAACAACTTGATGGAACTCAGAATGAGTGGGGTTGGTGCAAGCA...

CDS

Download CDS FASTA

1269 bp · TkAUNG016760|TK1151|CDS

GTTGATGTGTATCTTTCGAATGGAGTATGCGCTAGAGCTGCTGTTCCTAGTGGTGCATCCACTGGGATCTATGAAGCTCTCGAATTAAGAGATGGAGGATCGGACTACCTTGGAAAGGGTGTCTCAAAGGCCGTTGGCAACGTCAACAATACCATTGGACCTGCCCTCATTGGAAAGGACCCTACAGATCAGACTGGTATTGATAATTTCATGGTTCAACAACTTGATGGAACTCAGAATGAGTGGGGTTGGTGCAAGCA...

Protein

Download Protein FASTA

422 aa · TkAUNG016760|TK1151|PROTEIN

VDVYLSNGVCARAAVPSGASTGIYEALELRDGGSDYLGKGVSKAVGNVNNTIGPALIGKDPTDQTGIDNFMVQQLDGTQNEWGWCKQKLGANAILAVSLAVCKAGASVLNIPLYKHIANLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHHLKAVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAILKAGYTGKVVIGMDVAASEFYGTDKTYDLNFKEENNDGKQKISGDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG016760`
TK1151 ID	TkAUNG016760
OH-1004 ID	LXL04_014891
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 95.056 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG016760

Location ChrUn:4502983-4506314 (+)

Description Similar to Enolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36530`	Multifunctional enzyme that acts as an enolase involved in the metabolism and as a positive regulator of cold-responsive gene transcription.	LOS2, a genetic locus required for cold-responsive gene transcription encodes a bi-functional enolase.2002 · DOI: 10.1093/emboj/21.11.2692 Quantitative proteomics of the tonoplast reveals a role for glycolytic enzymes in salt tolerance.2009 · DOI: 10.1105/tpc.109.069211

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014891 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

dosa:Os10g0167300

rcu:8288376

sly:544068

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.728

Rank 1 · TkAUNG016760 · TK1151

Nucleus0.271

Rank 2 · TkAUNG016760 · TK1151

Mitochondrion0.140

Rank 3 · TkAUNG016760 · TK1151

Cell membrane0.129

Rank 4 · TkAUNG016760 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkAUNG016760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952Enolase_N1-117 aa

PF00113Enolase_C126-417 aa

PF13378MR_MLE_C251-382 aa

PF07476MAAL_C276-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG016760	`PF03952`	Enolase_N	1	117	3.7e-41	141.1
TkAUNG016760	`PF00113`	Enolase_C	126	417	1.6e-157	524.1
TkAUNG016760	`PF13378`	MR_MLE_C	251	382	1.4e-08	35.5
TkAUNG016760	`PF07476`	MAAL_C	276	379	8.2e-06	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25696`	Arabidopsis thaliana	sp\|P25696\|ENO2_ARATH Bifunctional enolase 2/transcriptional activator	90.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card