TkAUNG016680 | RubberDandelionOmics

Gene overview

TkAUNG016680

Reference: TK1151 Chr: ChrUn Coordinates: 4459788-4464953 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · TkAUNG016680|TK1151|cDNA

ATGACTACTACCACCACCTCAGCATTTGAAGTAATAAAGAATAGACTTCCAAGCAATGTCATATACCAGAATGTCTTCAAAGTCATTCCAAAATTGGTCTCATCCAGTAATTCTTCCATTAATCAAGTTGATGCTATCAAAATTTTCATTGATTCTCCCACTGCGATAGCTGATTTTGACAATTCGGGAGGAGTTAACAGAAGTCATGAAGAGTTTCAGGTACAGCTCTCCAATAGAAAAGTATGGATGGCTTCTTCAAT...

CDS

Download CDS FASTA

696 bp · TkAUNG016680|TK1151|CDS

ATGACTACTACCACCACCTCAGCATTTGAAGTAATAAAGAATAGACTTCCAAGCAATGTCATATACCAGAATGTCTTCAAAGTCATTCCAAAATTGGTCTCATCCAGTAATTCTTCCATTAATCAAGTTGATGCTATCAAAATTTTCATTGATTCTCCCACTGCGATAGCTGATTTTGACAATTCGGGAGGAGTTAACAGAAGTCATGAAGAGTTTCAGGTACAGCTCTCCAATAGAAAAGTATGGATGGCTTCTTCAAT...

Protein

Download Protein FASTA

231 aa · TkAUNG016680|TK1151|PROTEIN

MTTTTTSAFEVIKNRLPSNVIYQNVFKVIPKLVSSSNSSINQVDAIKIFIDSPTAIADFDNSGGVNRSHEEFQVQLSNRKVWMASSIHRGEEEVFIRAHDMLKQMHADILTIIVPILQEEGTSVALRSRGDNLTPESSIYVVDSLGELRDFYRLTPIAVVGGSFLVGSKGHNILEAAAAGCVVLTEMQRVNPLSVLQVSSEKLVEAVNELFGNAKILEARRGCQTSISFLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG016680`
TK1151 ID	TkAUNG016680
OH-1004 ID	LXL04_032581
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	50.800
Protein coverage (%)	TK1151 69.697 / OH-1004 39.278 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG016680

Location ChrUn:4459788-4464953 (-)

Description Similar to KDTA: Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03770`	Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032581 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009245 lipid A biosynthetic process Biological Process

GO:0036104 Kdo2-lipid A biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016740 transferase activity Molecular Function

GO:0043842 Kdo transferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G03770

ecc:c4457

ece:Z5057

ecj:JW3608

eco:b3633

ecoc:C3026_19690

ecs:ECs_4508

hin:HI_0652

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.404

Rank 1 · TkAUNG016680 · TK1151

Nucleus0.323

Rank 2 · TkAUNG016680 · TK1151

Plastid0.134

Rank 3 · TkAUNG016680 · TK1151

Mitochondrion0.101

Rank 4 · TkAUNG016680 · TK1151

Peroxisome0.082

Rank 5 · TkAUNG016680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08206OB_RNB90-112 aa

PF00534Glycos_transf_193-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG016680	`PF08206`	OB_RNB	90	112	0.051	14.0
TkAUNG016680	`PF00534`	Glycos_transf_1	93	185	0.17	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZA5`	Arabidopsis thaliana	sp\|Q8VZA5\|KDTA_ARATH Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card