TkAUNG015770 | RubberDandelionOmics

Gene overview

TkAUNG015770

Reference: TK1151 Chr: ChrUn Coordinates: 4198667-4202312 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2156 bp · TkAUNG015770|TK1151|cDNA

AAATGGAATCACTTCCGTTTGATCTGAATCTCAGTCTGTCACGCTCCCCATCATCTCTTTCTTCCGTCGCACTTCATTCCTTCTCCGAATTCAATCGAACTGCTACTCAACTTGTATCGATTTACATTAAATTCCCCATTCATGTATCCTCACAACCTCAACGATATTTTCATTTTCCTATTGTTAAACTGAGTTTCACCATACGATGATGGTGGATACCCTAACTTCATCGCCTTCGATGTGGCGCTTCCACCATCGCC...

CDS

Download CDS FASTA

1479 bp · TkAUNG015770|TK1151|CDS

ATGATGGTGGATACCCTAACTTCATCGCCTTCGATGTGGCGCTTCCACCATCGCCGTTGGATTCCCACCCTATTCTCTTCTTACAAAACCCTTTTCACTCTCCTCTGGATCGTCGGATTCACATCTGTTTTCATCTGGCAACACAACGTCGTCGATGGGTTCTTGATTTTCCGGCGGCCCCTCGTTTCTCGATCTTTTCCACAGCTCCGACCCATTGCTTTTAATATTACGGAATTCGGAGCTATCGGAGACGGCGTCAC...

Protein

Download Protein FASTA

492 aa · TkAUNG015770|TK1151|PROTEIN

MMVDTLTSSPSMWRFHHRRWIPTLFSSYKTLFTLLWIVGFTSVFIWQHNVVDGFLIFRRPLVSRSFPQLRPIAFNITEFGAIGDGVTLNTKAFENAVSVISKLGKRGGGQLNVPAGKWLTAPFNLTSHMTLFLAEGAVILAVDDEKLWPLMPPLPSYGYGREHVGPRYGSLIHGQHLKDIVITGHNGTINGQGQKWWRKFRQKRLNHTRGPLIQIMWSSDILISNITLRDSPFWTLHPYDCKNITITKMTILSPVFQAPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG015770`
TK1151 ID	TkAUNG015770
OH-1004 ID	LXL04_002301
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG015770

Location ChrUn:4198667-4202312 (+)

Description Similar to GSVIVT00026920001: Probable polygalacturonase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15720`	Probable polygalacturonase At3g15720.	No verified direct reference in this release
`At1g80170`	Probable polygalacturonase At1g80170.	No verified direct reference in this release
`At1g48100`	Polygalacturonase not involved in the final stages of pod shatter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002301 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0016020 membrane Cellular Component

GO:0004650 polygalacturonase activity Molecular Function

KEGG gene cross-reference

ath:AT1G48100

ath:AT1G80170

ath:AT3G15720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.287

Rank 1 · TkAUNG015770 · TK1151

Lysosome / Vacuole0.273

Rank 2 · TkAUNG015770 · TK1151

Golgi apparatus0.137

Rank 3 · TkAUNG015770 · TK1151

Cytoplasm0.132

Rank 4 · TkAUNG015770 · TK1151

Endoplasmic reticulum0.111

Rank 5 · TkAUNG015770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim74-120 aa

PF00295Glyco_hydro_28170-449 aa

PF12708Pect-lyase_RHGA_epim174-229 aa

PF13229Beta_helix220-289 aa

PF12708Pect-lyase_RHGA_epim244-352 aa

PF13229Beta_helix297-380 aa

PF13229Beta_helix417-441 aa

PF12708Pect-lyase_RHGA_epim421-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG015770	`PF12708`	Pect-lyase_RHGA_epim	74	120	4.5e-08	33.9
TkAUNG015770	`PF00295`	Glyco_hydro_28	170	449	1.5e-46	159.8
TkAUNG015770	`PF12708`	Pect-lyase_RHGA_epim	174	229	4.5e-08	33.9
TkAUNG015770	`PF13229`	Beta_helix	220	289	5.7e-05	23.5
TkAUNG015770	`PF12708`	Pect-lyase_RHGA_epim	244	352	4.5e-08	33.9
TkAUNG015770	`PF13229`	Beta_helix	297	380	5.7e-05	23.5
TkAUNG015770	`PF13229`	Beta_helix	417	441	5.7e-05	23.5
TkAUNG015770	`PF12708`	Pect-lyase_RHGA_epim	421	438	4.5e-08	33.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW07`	Arabidopsis thaliana	sp\|Q9LW07\|PGLR3_ARATH Probable polygalacturonase At3g15720	31.900%	Swiss-Prot	Medium
`Q94AJ5`	Arabidopsis thaliana	sp\|Q94AJ5\|PGLR5_ARATH Probable polygalacturonase At1g80170	27.000%	Swiss-Prot	Low
`Q949Z1`	Arabidopsis thaliana	sp\|Q949Z1\|PGLR4_ARATH Polygalacturonase At1g48100	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card