TkAUNG013490 | RubberDandelionOmics

Gene overview

TkAUNG013490

Reference: TK1151 Chr: ChrUn Coordinates: 3449109-3452984 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1514 bp · TkAUNG013490|TK1151|cDNA

TTAAGACCTAATTTAAATGGTCAAACTTTAATTGCAAAATCGTGTCAAAATTGATCGAAACTCGGTTCTTTGATATCCTTTCAAAAATATCTTGCGGTTGCAGTTTAGAGACGTTTACCGGAATAAGTGGAAAATATGAAAGCCACCAATACCAACTGAAATTCAAACACACACAGAGACACAGAGTCACCATGTCTCGATCAATTTACCCGTCTACTGTAACCCTAGTCCTCAGATCAATGGCAACCAAAAGACCACAA...

CDS

Download CDS FASTA

693 bp · TkAUNG013490|TK1151|CDS

ATGTCTCGATCAATTTACCCGTCTACTGTAACCCTAGTCCTCAGATCAATGGCAACCAAAAGACCACAATCATCCGTCGTCTCAAAAAGAAGAACCGCCACTGCTGCTACTATGTCTGCTCTTGAAGCTCGAGTTTCTCTTATATTTGCTCTCGCCTCCCAAACTAGTTCCGTCTCTCAGCGACTTTTGACGGATTTAGCAACAGAGACGGCCAAGTACGTGTTTCCGAAGAGGTTTGAAAGTCGGAATTTAGAAGAAGC...

Protein

Download Protein FASTA

230 aa · TkAUNG013490|TK1151|PROTEIN

MSRSIYPSTVTLVLRSMATKRPQSSVVSKRRTATAATMSALEARVSLIFALASQTSSVSQRLLTDLATETAKYVFPKRFESRNLEEALMSVPDLETVKFKVLTRNDQYEIRELQPYFVAETTMPGKYGFDLNGASQSFNVLAEYLFGKNTSNEAMEMTTPVFTRKTQSEGVTMDMTTPVITKKKEDEDNWKMSFILPSKYGSNFPLPKNSAVTIKEGQVELLLLLPFQGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG013490`
TK1151 ID	TkAUNG013490
OH-1004 ID	LXL04_013608
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 99.565 / OH-1004 76.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG013490

Location ChrUn:3449109-3452984 (+)

Description Similar to At3g10130: Heme-binding-like protein At3g10130, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10130`	Heme-binding-like protein At3g10130, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013608 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT3G10130

xla:414628

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.610

Rank 1 · TkAUNG013490 · TK1151

Mitochondrion0.203

Rank 2 · TkAUNG013490 · TK1151

Cytoplasm0.070

Rank 3 · TkAUNG013490 · TK1151

Cell membrane0.055

Rank 4 · TkAUNG013490 · TK1151

Extracellular0.051

Rank 5 · TkAUNG013490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04832SOUL94-169 aa

PF15402MELT_2153-161 aa

PF15402MELT_2166-179 aa

PF04832SOUL167-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG013490	`PF04832`	SOUL	94	169	6.7e-28	98.6
TkAUNG013490	`PF15402`	MELT_2	153	161	0.0065	16.9
TkAUNG013490	`PF15402`	MELT_2	166	179	0.0065	16.9
TkAUNG013490	`PF04832`	SOUL	167	229	6.7e-28	98.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SR77`	Arabidopsis thaliana	sp\|Q9SR77\|HBPL1_ARATH Heme-binding-like protein At3g10130, chloroplastic	66.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card