TkAUNG013070 | RubberDandelionOmics

Gene overview

TkAUNG013070

Reference: TK1151 Chr: ChrUn Coordinates: 3326327-3327981 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1290 bp · TkAUNG013070|TK1151|cDNA

ATGGTCGGCGAAGTCACAGCGGTATCCGGAATTTTAGAGTTTACCGCTGGCGAAGTTCATGGTATCGGGGAAGCCAGCGGTAAACTTTGCCAGCGCATGAGGAGATACAGTAAAAATACTTCATCAAATCGTAGAGGGTCTAACTCTTCTTCGCAACCCAACGAAGATAGCCCTCCGCAGCAAGAGGGATACCGCCCAACATTTGATCATGCGCTACATCAACAAAATCTGGCGTTTCAAGCTTGGCTGCAATCACAACC...

CDS

Download CDS FASTA

1290 bp · TkAUNG013070|TK1151|CDS

ATGGTCGGCGAAGTCACAGCGGTATCCGGAATTTTAGAGTTTACCGCTGGCGAAGTTCATGGTATCGGGGAAGCCAGCGGTAAACTTTGCCAGCGCATGAGGAGATACAGTAAAAATACTTCATCAAATCGTAGAGGGTCTAACTCTTCTTCGCAACCCAACGAAGATAGCCCTCCGCAGCAAGAGGGATACCGCCCAACATTTGATCATGCGCTACATCAACAAAATCTGGCGTTTCAAGCTTGGCTGCAATCACAACC...

Protein

Download Protein FASTA

429 aa · TkAUNG013070|TK1151|PROTEIN

MVGEVTAVSGILEFTAGEVHGIGEASGKLCQRMRRYSKNTSSNRRGSNSSSQPNEDSPPQQEGYRPTFDHALHQQNLAFQAWLQSQPQYQYQQPQQPQYPTPQYPKHQYQYQQPQYQTPSPQYQTPSPTFYTPSPLSQTSSPQFQPPSPFTEESTQEVPETQADDSDSEESDEEEVPRNKGKAVRKNWTNLEEEVLAQAWCGISEDARYGNDQNAKQFWKHVTRRFNKLLGKCRHYRTFDQCNSKWNKMNREVQKFNGAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG013070`
TK1151 ID	TkAUNG013070
OH-1004 ID	LXL04_010896
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.400
Protein coverage (%)	TK1151 100.000 / OH-1004 28.155 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG013070`
Location	ChrUn:3326327-3327981 (-)
Description	Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010896` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.949

Rank 1 · TkAUNG013070 · TK1151

Cytoplasm0.176

Rank 2 · TkAUNG013070 · TK1151

Mitochondrion0.017

Rank 3 · TkAUNG013070 · TK1151

Cell membrane0.016

Rank 4 · TkAUNG013070 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkAUNG013070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02043Bac_chlorC15-67 aa

PF13837Myb_DNA-bind_434-45 aa

PF13837Myb_DNA-bind_4185-256 aa

PF13873Myb_DNA-bind_5213-254 aa

PF20203DUF6565213-235 aa

PF20203DUF6565244-285 aa

PF13837Myb_DNA-bind_4291-297 aa

PF02043Bac_chlorC357-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG013070	`PF02043`	Bac_chlorC	15	67	1.1	10.1
TkAUNG013070	`PF13837`	Myb_DNA-bind_4	34	45	4.7e-06	27.6
TkAUNG013070	`PF13837`	Myb_DNA-bind_4	185	256	4.7e-06	27.6
TkAUNG013070	`PF13873`	Myb_DNA-bind_5	213	254	0.012	16.2
TkAUNG013070	`PF20203`	DUF6565	213	235	0.39	12.1
TkAUNG013070	`PF20203`	DUF6565	244	285	0.39	12.1
TkAUNG013070	`PF13837`	Myb_DNA-bind_4	291	297	4.7e-06	27.6
TkAUNG013070	`PF02043`	Bac_chlorC	357	380	1.1	10.1
TkAUNG013070	`PF20203`	DUF6565	373	385	0.39	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card