TkAUNG012680 | RubberDandelionOmics

Gene overview

TkAUNG012680

Reference: TK1151 Chr: ChrUn Coordinates: 3206785-3208565 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · TkAUNG012680|TK1151|cDNA

ATGGCTTGTTTTTCAAGCAAAAGATTAGCCATGAAGCAAGTCTTGGTTTGTTGGTTTCTTTTGTTTGTCACATTGATTCCTCAAAGCCATGCAAATTGTGCCTTCGATGCCATTTTCATGTTCGGAGACTCGAATTCCGATACAGGTGGATTCTACGCAGCTTTTCCTTCTCAACCATCGCCCCATGGCATGACCTACTTCGGAAAACCAACCGGCCGCCCCACGGATGGGAGGCTGTACATCGACTTCCTAGCTCAAGC...

CDS

Download CDS FASTA

1170 bp · TkAUNG012680|TK1151|CDS

ATGGCTTGTTTTTCAAGCAAAAGATTAGCCATGAAGCAAGTCTTGGTTTGTTGGTTTCTTTTGTTTGTCACATTGATTCCTCAAAGCCATGCAAATTGTGCCTTCGATGCCATTTTCATGTTCGGAGACTCGAATTCCGATACAGGTGGATTCTACGCAGCTTTTCCTTCTCAACCATCGCCCCATGGCATGACCTACTTCGGAAAACCAACCGGCCGCCCCACGGATGGGAGGCTGTACATCGACTTCCTAGCTCAAGC...

Protein

Download Protein FASTA

389 aa · TkAUNG012680|TK1151|PROTEIN

MACFSSKRLAMKQVLVCWFLLFVTLIPQSHANCAFDAIFMFGDSNSDTGGFYAAFPSQPSPHGMTYFGKPTGRPTDGRLYIDFLAQALGLPFLSPYLQSIGSDFRHGVNFATSASPVLQPNSSLFVTGISPFYLAVQINQMKQLRPKVMLMFESLFIGESNLPHPDIFGKALYVIWIGQNDVTHDVASLGSGGLKPYEPQIAGEIINAIKELYGLGGRTFFVMNIAPVGCYAAALSQISHSGSDVDSAGCMVSFNEAVKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012680`
TK1151 ID	TkAUNG012680
OH-1004 ID	LXL04_026663
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	56.100
Protein coverage (%)	TK1151 89.717 / OH-1004 93.548 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012680

Location ChrUn:3206785-3208565 (-)

Description Similar to At4g01130: GDSL esterase/lipase At4g01130

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01130`	GDSL esterase/lipase At4g01130.	No verified direct reference in this release
`At1g67830`	Hydrolyzes alpha-1,2-linked fucose.	AtFXG1, an Arabidopsis gene encoding alpha-L-fucosidase active against fucosylated xyloglucan oligosaccharides.2002 · DOI: 10.1104/pp.128.1.247
`At3g26430`	Lipase that can hydrolyze p-nitrophenyl butyrate and p- nitrophenyl palmitate in vitro.	The Arabidopsis thaliana ortholog of a purported maize cholinesterase gene encodes a GDSL-lipase.2013 · DOI: 10.1007/s11103-013-0021-8
`At5g14450`	GDSL esterase/lipase At5g14450.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006581 acetylcholine catabolic process Biological Process

GO:0009877 nodulation Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043659 symbiosome Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004560 alpha-L-fucosidase activity Molecular Function

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G67830

ath:AT3G26430

ath:AT4G01130

mtr:25482476

zma:606473

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.353

Rank 1 · TkAUNG012680 · TK1151

Lysosome / Vacuole0.224

Rank 2 · TkAUNG012680 · TK1151

Cytoplasm0.182

Rank 3 · TkAUNG012680 · TK1151

Endoplasmic reticulum0.166

Rank 4 · TkAUNG012680 · TK1151

Cell membrane0.076

Rank 5 · TkAUNG012680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL38-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012680	`PF00657`	Lipase_GDSL	38	367	7.9e-42	144.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M153`	Arabidopsis thaliana	sp\|Q9M153\|GDL61_ARATH GDSL esterase/lipase At4g01130	58.100%	Swiss-Prot	High
`Q9FXE5`	Arabidopsis thaliana	sp\|Q9FXE5\|FUCO3_ARATH Alpha-L-fucosidase 3	42.300%	Swiss-Prot	Medium
`Q9LIN2`	Arabidopsis thaliana	sp\|Q9LIN2\|GDL53_ARATH GDSL esterase/lipase At3g26430	40.700%	Swiss-Prot	Medium
`Q9LY84`	Arabidopsis thaliana	sp\|Q9LY84\|GDL76_ARATH GDSL esterase/lipase At5g14450	38.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card