TkAUNG012630 | RubberDandelionOmics

Gene overview

TkAUNG012630

Reference: TK1151 Chr: ChrUn Coordinates: 3191114-3193725 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · TkAUNG012630|TK1151|cDNA

ATGTTCATCCCAAGGTATGAGAGCAATAGCTTCTACAATCAGACAACTCTTCCCGGAAATGTCCAAATCTGCGGCAACCGAACGGCATCTCAGCCAACGGCATTCGATGCAACGGGACAGACACTACTCCGTGATCTTCAACTGTCAACACCAAGAATCACCGACTACTTCGCAGCAACTAAGAGGCAAATCTCAAACCTCGACAATTCAACCATCTATGGGATTGCACAATGTGCTGAAACAATCACCCAAAGTGGCTG...

CDS

Download CDS FASTA

1134 bp · TkAUNG012630|TK1151|CDS

ATGTTCATCCCAAGGTATGAGAGCAATAGCTTCTACAATCAGACAACTCTTCCCGGAAATGTCCAAATCTGCGGCAACCGAACGGCATCTCAGCCAACGGCATTCGATGCAACGGGACAGACACTACTCCGTGATCTTCAACTGTCAACACCAAGAATCACCGACTACTTCGCAGCAACTAAGAGGCAAATCTCAAACCTCGACAATTCAACCATCTATGGGATTGCACAATGTGCTGAAACAATCACCCAAAGTGGCTG...

Protein

Download Protein FASTA

377 aa · TkAUNG012630|TK1151|PROTEIN

MFIPRYESNSFYNQTTLPGNVQICGNRTASQPTAFDATGQTLLRDLQLSTPRITDYFAATKRQISNLDNSTIYGIAQCAETITQSGCQDCLTVAYSNIQSCLPDADGRAIDAACFLRYSDTPFFADNQTIDITPFLGEERGNSSKKIAIIGGVVGGGGFGLILLAFCYVKKLDISYSRAKEDFESDKRGSLTWKQRFDIIFGTARGLAYLHEHEQYHVTIIHRDIKPSNILLDDEFQAKIADFGLARLLPENQSHVSTKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012630`
TK1151 ID	TkAUNG012630
OH-1004 ID	LXL04_013992
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	47.100
Protein coverage (%)	TK1151 97.082 / OH-1004 73.457 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012630

Location ChrUn:3191114-3193725 (-)

Description Similar to CRK3: Cysteine-rich receptor-like protein kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At1g70520`	Cysteine-rich receptor-like protein kinase 2.	No verified direct reference in this release
`At1g16670`	Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress.	No verified direct reference in this release
`At1g70740`	Cysteine-rich receptor-like protein kinase 43.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013992 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010193 response to ozone Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0052545 callose localization Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G19090

ath:AT1G70520

ath:AT1G70530

ath:AT4G05200

ath:AT5G40380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · TkAUNG012630 · TK1151

Endoplasmic reticulum0.089

Rank 2 · TkAUNG012630 · TK1151

Cytoplasm0.074

Rank 3 · TkAUNG012630 · TK1151

Nucleus0.043

Rank 4 · TkAUNG012630 · TK1151

Lysosome / Vacuole0.029

Rank 5 · TkAUNG012630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung24-120 aa

PF07714PK_Tyr_Ser-Thr180-364 aa

PF00069Pkinase187-364 aa

PF12330Haspin_kinase193-256 aa

PF01636APH206-247 aa

PF10140YukC211-253 aa

PF03109ABC1214-254 aa

PF17667Pkinase_fungal217-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012630	`PF01657`	Stress-antifung	24	120	5.8e-13	50.1
TkAUNG012630	`PF07714`	PK_Tyr_Ser-Thr	180	364	1.5e-20	74.3
TkAUNG012630	`PF00069`	Pkinase	187	364	4.8e-23	82.6
TkAUNG012630	`PF12330`	Haspin_kinase	193	256	0.16	11.7
TkAUNG012630	`PF01636`	APH	206	247	0.026	15.0
TkAUNG012630	`PF10140`	YukC	211	253	0.22	11.1
TkAUNG012630	`PF03109`	ABC1	214	254	0.057	13.3
TkAUNG012630	`PF17667`	Pkinase_fungal	217	269	0.12	11.8
TkAUNG012630	`PF23428`	DUF7115	267	304	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGH3`	Arabidopsis thaliana	sp\|C0LGH3\|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140	49.200%	Swiss-Prot	Low
`C0LGH2`	Arabidopsis thaliana	sp\|C0LGH2\|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130	49.200%	Swiss-Prot	Low
`Q9CAL3`	Arabidopsis thaliana	sp\|Q9CAL3\|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2	47.200%	Swiss-Prot	Low
`Q93YN1`	Arabidopsis thaliana	sp\|Q93YN1\|CRPK1_ARATH Cold-responsive protein kinase 1	48.900%	Swiss-Prot	Low
`Q9CAC3`	Arabidopsis thaliana	sp\|Q9CAC3\|CRK43_ARATH Cysteine-rich receptor-like protein kinase 43	42.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card