TkAUNG012550 | RubberDandelionOmics

Gene overview

TkAUNG012550

Reference: TK1151 Chr: ChrUn Coordinates: 3137609-3138195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkAUNG012550|TK1151|cDNA

CTCTCTCTCATTCTCCTCTACATTCACACCATCCCTTCCCTCTCCGAACAACCTGCTCCGGTGGTCGACATAGACGGGGCCCATCTCCGAGCTGGAGTCCGCTACTACATTTTGCCCGTCATACGTGGCAGAGGTGGTGGCCTGACAATAGCCGCCGCCACCACCAACAAACTTGCTCACTCGACATTGTCCAAGAGCAATTTGAAGTCAAAAAGGGGCTCCCAGTTCAAGATCGAACGATATGAAAGCCATTACAAGCT...

CDS

Download CDS FASTA

393 bp · TkAUNG012550|TK1151|CDS

CTCTCTCTCATTCTCCTCTACATTCACACCATCCCTTCCCTCTCCGAACAACCTGCTCCGGTGGTCGACATAGACGGGGCCCATCTCCGAGCTGGAGTCCGCTACTACATTTTGCCCGTCATACGTGGCAGAGGTGGTGGCCTGACAATAGCCGCCGCCACCACCAACAAACTTGCTCACTCGACATTGTCCAAGAGCAATTTGAAGTCAAAAAGGGGCTCCCAGTTCAAGATCGAACGATATGAAAGCCATTACAAGCT...

Protein

Download Protein FASTA

130 aa · TkAUNG012550|TK1151|PROTEIN

LSLILLYIHTIPSLSEQPAPVVDIDGAHLRAGVRYYILPVIRGRGGGLTIAAATTNKLAHSTLSKSNLKSKRGSQFKIERYESHYKLFFCPTVCNYCKVVCKDVGVLVEDGKRRLTLTEDDPFKIMFKKA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012550`
TK1151 ID	TkAUNG012550
OH-1004 ID	LXL04_008374
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	37.600
Protein coverage (%)	TK1151 98.462 / OH-1004 97.970 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012550

Location ChrUn:3137609-3138195 (+)

Description Similar to KTI5: Kunitz trypsin inhibitor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17860`	Can inhibit both serine proteases and cysteine proteases.	Arabidopsis Kunitz Trypsin Inhibitors in Defense Against Spider Mites.2018 · DOI: 10.3389/fpls.2018.00986

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008374 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009624 response to nematode Biological Process

GO:0009625 response to insect Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010466 negative regulation of peptidase activity Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G17860

ath:AT1G73260

dosa:Os04g0526600

tcc:18604292

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.478

Rank 1 · TkAUNG012550 · TK1151

Cytoplasm0.183

Rank 2 · TkAUNG012550 · TK1151

Lysosome / Vacuole0.141

Rank 3 · TkAUNG012550 · TK1151

Endoplasmic reticulum0.133

Rank 4 · TkAUNG012550 · TK1151

Nucleus0.059

Rank 5 · TkAUNG012550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00197Kunitz_legume21-66 aa

PF00197Kunitz_legume67-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012550	`PF00197`	Kunitz_legume	21	66	6.7e-25	88.7
TkAUNG012550	`PF00197`	Kunitz_legume	67	129	6.7e-25	88.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMU2`	Arabidopsis thaliana	sp\|Q9LMU2\|KTI5_ARATH Kunitz trypsin inhibitor 5	37.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card