TkAUNG012440 | RubberDandelionOmics

Gene overview

TkAUNG012440

Reference: TK1151 Chr: ChrUn Coordinates: 3081886-3084032 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · TkAUNG012440|TK1151|cDNA

ATGACAGAAAATCTTGACAGAGCATGGCCGTGGCCGTATATTATCATCAGCTTCATGTCACTCATTTTGATCGTAGCAAAATTGTTTCCAAATAAGAAGAAAAATTGTGCAGGAATAAGCAAGTTGAAGTTACCTCCTGGAGGAAGAGGGTGGCCCATCATAGGGGATAGCATCAGTTGGTATAATGCCGTTGCTAGTTCTCATCCCCCTTGTTTCGTCGAGCAACAAGTGAAAAGGTATGGCAAGATATTTTCATGCAG...

CDS

Download CDS FASTA

1413 bp · TkAUNG012440|TK1151|CDS

ATGACAGAAAATCTTGACAGAGCATGGCCGTGGCCGTATATTATCATCAGCTTCATGTCACTCATTTTGATCGTAGCAAAATTGTTTCCAAATAAGAAGAAAAATTGTGCAGGAATAAGCAAGTTGAAGTTACCTCCTGGAGGAAGAGGGTGGCCCATCATAGGGGATAGCATCAGTTGGTATAATGCCGTTGCTAGTTCTCATCCCCCTTGTTTCGTCGAGCAACAAGTGAAAAGGTATGGCAAGATATTTTCATGCAG...

Protein

Download Protein FASTA

470 aa · TkAUNG012440|TK1151|PROTEIN

MTENLDRAWPWPYIIISFMSLILIVAKLFPNKKKNCAGISKLKLPPGGRGWPIIGDSISWYNAVASSHPPCFVEQQVKRYGKIFSCSLFGRWAVVSADPAFNRFVMQNEGRLFQSSYPKSFRDLVGKNGVINAQGEQQRKLHSIASNMMRLDKLKCHFLQDIQIVMKQIMSNLHDNQVVLLQDVCRKVAINLMVNQLLGVSSESEVNEISQLFSDFADGCLSIPIKLPGFAYNKAMKARENIISKINRTMEIHRLKSSPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012440`
TK1151 ID	TkAUNG012440
OH-1004 ID	LXL04_024559
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	34.400
Protein coverage (%)	TK1151 83.617 / OH-1004 69.692 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012440

Location ChrUn:3081886-3084032 (-)

Description Similar to CYP90B1: Cytochrome P450 90B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50660`	Catalyzes the C22-alpha-hydroxylation step in brassinosteroids biosynthesis.	Arabidopsis CYP90B1 catalyses the early C-22 hydroxylation of C27, C28 and C29 sterols.2006 · DOI: 10.1111/j.1365-313x.2005.02639.x The DWF4 gene of Arabidopsis encodes a cytochrome P450 that mediates multiple 22alpha-hydroxylation steps in brassinosteroid biosynthesis.1998 · DOI: 10.1105/tpc.10.2.231

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024559 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0010358 leaf shaping Biological Process

GO:0016132 brassinosteroid biosynthetic process Biological Process

GO:0048366 leaf development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G50660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.874

Rank 1 · TkAUNG012440 · TK1151

Golgi apparatus0.053

Rank 2 · TkAUNG012440 · TK1151

Nucleus0.046

Rank 3 · TkAUNG012440 · TK1151

Cytoplasm0.043

Rank 4 · TkAUNG012440 · TK1151

Cell membrane0.033

Rank 5 · TkAUNG012440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45045-425 aa

PF18532DUF5621104-129 aa

PF00316FBPase122-149 aa

PF14542Acetyltransf_CG334-385 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012440	`PF00067`	p450	45	425	1.6e-47	163.1
TkAUNG012440	`PF18532`	DUF5621	104	129	0.1	13.1
TkAUNG012440	`PF00316`	FBPase	122	149	0.2	11.9
TkAUNG012440	`PF14542`	Acetyltransf_CG	334	385	0.23	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64989`	Arabidopsis thaliana	sp\|O64989\|C90B1_ARATH Steroid (22S)-hydroxylase	35.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card