TkAUNG012260 | RubberDandelionOmics

Gene overview

TkAUNG012260

Reference: TK1151 Chr: ChrUn Coordinates: 2965811-2966258 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkAUNG012260|TK1151|cDNA

ATGTGGAAGGATAAGTCTCCACTGCTGCCTTCTGATCCTTACCAGAGAGCTCAAGCTAGATTCTGGGTTGACTTTGTTGACAAAAAGGTAAATAACCGCGCATGGATAGTGTTCGTGGAAGCTGGAGAAGAGCAAGAAGAATGCAAGAAACAACTGATGGAGGCCCTCAAGATCTTGGAAGAAGAGTTGGGAGACAAGACTTATTTTGGTGGTGACAAGTTAGGGTTGGTAGATGTAGCCCTAATTACTTTCTACAACTG...

CDS

Download CDS FASTA

348 bp · TkAUNG012260|TK1151|CDS

ATGTGGAAGGATAAGTCTCCACTGCTGCCTTCTGATCCTTACCAGAGAGCTCAAGCTAGATTCTGGGTTGACTTTGTTGACAAAAAGGTAAATAACCGCGCATGGATAGTGTTCGTGGAAGCTGGAGAAGAGCAAGAAGAATGCAAGAAACAACTGATGGAGGCCCTCAAGATCTTGGAAGAAGAGTTGGGAGACAAGACTTATTTTGGTGGTGACAAGTTAGGGTTGGTAGATGTAGCCCTAATTACTTTCTACAACTG...

Protein

Download Protein FASTA

115 aa · TkAUNG012260|TK1151|PROTEIN

MWKDKSPLLPSDPYQRAQARFWVDFVDKKVNNRAWIVFVEAGEEQEECKKQLMEALKILEEELGDKTYFGGDKLGLVDVALITFYNWFYTVETFGKFSIEEECPKLWRGESVAWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012260`
TK1151 ID	TkAUNG012260
OH-1004 ID	LXL04_001748
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.000
Protein coverage (%)	TK1151 99.130 / OH-1004 24.176 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012260

Location ChrUn:2965811-2966258 (+)

Description Similar to Probable glutathione S-transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17180`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At1g78370`	Exhibits glutathione-dependent thiol transferase activities.	No verified direct reference in this release
`At1g78340`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0046256 2,4,6-trinitrotoluene catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17180

nta:107782951

nta:107823949

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.725

Rank 1 · TkAUNG012260 · TK1151

Nucleus0.173

Rank 2 · TkAUNG012260 · TK1151

Peroxisome0.092

Rank 3 · TkAUNG012260 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkAUNG012260 · TK1151

Mitochondrion0.076

Rank 5 · TkAUNG012260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02100ODC_AZ24-64 aa

PF16865GST_C_535-105 aa

PF14497GST_C_341-106 aa

PF00043GST_C42-105 aa

PF22041GST_C_743-91 aa

PF13410GST_C_245-108 aa

PF17171GST_C_654-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012260	`PF02100`	ODC_AZ	24	64	0.11	13.1
TkAUNG012260	`PF16865`	GST_C_5	35	105	0.022	16.1
TkAUNG012260	`PF14497`	GST_C_3	41	106	0.00063	20.6
TkAUNG012260	`PF00043`	GST_C	42	105	6e-12	46.4
TkAUNG012260	`PF22041`	GST_C_7	43	91	0.031	14.9
TkAUNG012260	`PF13410`	GST_C_2	45	108	1.4e-11	45.0
TkAUNG012260	`PF17171`	GST_C_6	54	81	0.00096	19.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHH7`	Arabidopsis thaliana	sp\|Q9SHH7\|GSTUP_ARATH Glutathione S-transferase U25	60.500%	Swiss-Prot	High
`Q8L7C9`	Arabidopsis thaliana	sp\|Q8L7C9\|GSTUK_ARATH Glutathione S-transferase U20	59.300%	Swiss-Prot	High
`Q8GYM1`	Arabidopsis thaliana	sp\|Q8GYM1\|GSTUM_ARATH Glutathione S-transferase U22	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card