TkAUNG009010 | RubberDandelionOmics

Gene overview

TkAUNG009010

Reference: TK1151 Chr: ChrUn Coordinates: 2273840-2276441 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1952 bp · TkAUNG009010|TK1151|cDNA

GTCAAACCCAAACCCCTGAAAAACTGAAGAAACAACTTTGAAGAGGTGTCACGTGAGTGGAACGTGGCACGCGGCGTGGGGGCACAACACTGATTGGAAGCAATATGGCGCTTCCACGATGAAGACGACGACACACCGCCGGAGCCACAGCTGTTAAAAACTCCGAAGAACAAACAAACAACTCACACAACACCAACGCCGTGTGTGATTTTATTCAAACCCTCAATTACAGAACCAGTATCTGTGAAATTATGGTGAAG...

CDS

Download CDS FASTA

1356 bp · TkAUNG009010|TK1151|CDS

ATGGTGAAGAAACGAGTTCCTGATTGGCTTAATAGCCCCATGTGGTCTTCTCCCACAGTTTCCACATCTCCACCGCCGAAATCACGATCGCTATCGCCTTCCAACGACGATCGATATGGTGGTTACCCTTCCAAATCTTCCTCCGTCACGTCGTCCGATTCTTCTCTGAATGAACCACATGATCCGTTGCCGCCTCCTACTTCAATCAAACATGAACCGAGTCCGAGGACGGGAATTAGGGATCCATCGACCCGTAGCGT...

Protein

Download Protein FASTA

451 aa · TkAUNG009010|TK1151|PROTEIN

MVKKRVPDWLNSPMWSSPTVSTSPPPKSRSLSPSNDDRYGGYPSKSSSVTSSDSSLNEPHDPLPPPTSIKHEPSPRTGIRDPSTRSVISDNDVSSSVEDEPRQAQLLEELSRKIINIGELRQLSLLGIPDTAGIRSTVWKLLLAYLPIDKGLWSSELSKKRSQYKQFKENLLMNPSEITMNSEDSAFFKNGDLSEGKGLLERSKLSQGEHPLSLGKTSIWHQFFQDSEIIEQIDRDVKRTHPDIPFFCGDSASSKANQES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG009010`
TK1151 ID	TkAUNG009010
OH-1004 ID	LXL04_033292
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.900
Protein coverage (%)	TK1151 99.778 / OH-1004 99.140 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG009010`
Location	ChrUn:2273840-2276441 (-)
Description	Similar to Tbc1d13: TBC1 domain family member 13
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033292` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0005096 GTPase activator activity Molecular Function GO:0031267 small GTPase binding Molecular Function
KEGG gene cross-reference	hsa:54662 mmu:70296 spo:2542551 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · TkAUNG009010 · TK1151

Nucleus0.239

Rank 2 · TkAUNG009010 · TK1151

Golgi apparatus0.184

Rank 3 · TkAUNG009010 · TK1151

Lysosome / Vacuole0.135

Rank 4 · TkAUNG009010 · TK1151

Cell membrane0.129

Rank 5 · TkAUNG009010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22139XPD_arch106-165 aa

PF00566RabGAP-TBC134-168 aa

PF00566RabGAP-TBC226-418 aa

PF23436RabGap-TBC_2258-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG009010	`PF22139`	XPD_arch	106	165	0.088	13.7
TkAUNG009010	`PF00566`	RabGAP-TBC	134	168	7.4e-42	144.2
TkAUNG009010	`PF00566`	RabGAP-TBC	226	418	7.4e-42	144.2
TkAUNG009010	`PF23436`	RabGap-TBC_2	258	432	1.5e-08	35.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card