TkAUNG006740 | RubberDandelionOmics

Gene overview

TkAUNG006740

Reference: TK1151 Chr: ChrUn Coordinates: 1870579-1872288 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1710 bp · TkAUNG006740|TK1151|cDNA

ATGAGCACGTCAATATATGAATTGTTTCATTATTCGTTATTTCCGGGTCTTTTCGTTGCATTCACTTACAACAAGAAAGAACCACCAGTGTTTGGTGCAGCACCTGCATTTTGGTGCATTCTTCTTTCTTTCCTTGGTCTTCCGTTCCGTCATATTCCTAATAACTTATCCAATGACAACGAATTAACCGCAAATGCACCTTTCTTTTATCAAATCTCAGGGACATGGTCTAATCATGAGGGTAGTATTTTATCATGGTG...

CDS

Download CDS FASTA

1710 bp · TkAUNG006740|TK1151|CDS

ATGAGCACGTCAATATATGAATTGTTTCATTATTCGTTATTTCCGGGTCTTTTCGTTGCATTCACTTACAACAAGAAAGAACCACCAGTGTTTGGTGCAGCACCTGCATTTTGGTGCATTCTTCTTTCTTTCCTTGGTCTTCCGTTCCGTCATATTCCTAATAACTTATCCAATGACAACGAATTAACCGCAAATGCACCTTTCTTTTATCAAATCTCAGGGACATGGTCTAATCATGAGGGTAGTATTTTATCATGGTG...

Protein

Download Protein FASTA

569 aa · TkAUNG006740|TK1151|PROTEIN

MSTSIYELFHYSLFPGLFVAFTYNKKEPPVFGAAPAFWCILLSFLGLPFRHIPNNLSNDNELTANAPFFYQISGTWSNHEGSILSWCRILSFYGFLLCYRGRPQSHNVSKRGGHRESLFSSFVSNFVKNSILSLPSYEQKTGATTQLYTPFVLRTLVDSELRSRRHRTFYGPALFYAPFSQRSFAPLGARRFRGSREGKRTHPFLHLARDDKERASSIDEQRIDGALGIALFFSPFLSASSDPFVRNFFVRTEPLAESNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG006740`
TK1151 ID	TkAUNG006740
OH-1004 ID	LXL04_040110
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.100
Protein coverage (%)	TK1151 66.608 / OH-1004 44.059 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG006740

Location ChrUn:1870579-1872288 (+)

Description Similar to Probable cytochrome c biosynthesis protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9T6H8`	Forms a complex with CCMFC, CCMFN2 and CCMH that performs the assembly of heme with c-type apocytochromes in mitochondria.	No verified direct reference in this release
`AtMg00960`	Forms a complex with CCMFC, CCMFN1 and CCMH that performs the assembly of heme with c-type apocytochromes in mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_040110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0017004 cytochrome complex assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0015232 heme transmembrane transporter activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.404

Rank 1 · TkAUNG006740 · TK1151

Cytoplasm0.250

Rank 2 · TkAUNG006740 · TK1151

Nucleus0.214

Rank 3 · TkAUNG006740 · TK1151

Plastid0.078

Rank 4 · TkAUNG006740 · TK1151

Cell membrane0.071

Rank 5 · TkAUNG006740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13493DUF411831-53 aa

PF01578Cytochrom_C_asm76-132 aa

PF13493DUF4118109-138 aa

PF01578Cytochrom_C_asm230-497 aa

PF13493DUF4118362-384 aa

PF13493DUF4118500-542 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG006740	`PF13493`	DUF4118	31	53	5.7	7.5
TkAUNG006740	`PF01578`	Cytochrom_C_asm	76	132	1.4e-21	77.9
TkAUNG006740	`PF13493`	DUF4118	109	138	5.7	7.5
TkAUNG006740	`PF01578`	Cytochrom_C_asm	230	497	1.4e-21	77.9
TkAUNG006740	`PF13493`	DUF4118	362	384	5.7	7.5
TkAUNG006740	`PF13493`	DUF4118	500	542	5.7	7.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T6H8`	Arabidopsis thaliana	sp\|Q9T6H8\|CCMF1_ARATH Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 1	80.200%	Swiss-Prot	Medium
`Q33884`	Arabidopsis thaliana	sp\|Q33884\|CCMF2_ARATH Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 2 (Fragment)	89.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card