TkAUNG004870 | RubberDandelionOmics

Gene overview

TkAUNG004870

Reference: TK1151 Chr: ChrUn Coordinates: 1465130-1467153 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkAUNG004870|TK1151|cDNA

ATGCCTATTGGTGTTCCAAAAGTACCTTTTCGAAGTCCTGGAGAGGAAGATGCAACTTGGGTTGACATATACAACCGACTTTATCGAGAAAGATTACTTTTTTTAGGTCAAGAGGTTGATAGCGAGATCTCGAATCAACTTATTGGTCTTATGATATATCTCAGTATTGAGGATGATACCAAAGATCTGTATTTGTTTATAAACTCTCCTGGCGGATGGGTAATACCGGGGGTGTCTCTTTATGATACTATGCAATTTGT...

CDS

Download CDS FASTA

591 bp · TkAUNG004870|TK1151|CDS

ATGCCTATTGGTGTTCCAAAAGTACCTTTTCGAAGTCCTGGAGAGGAAGATGCAACTTGGGTTGACATATACAACCGACTTTATCGAGAAAGATTACTTTTTTTAGGTCAAGAGGTTGATAGCGAGATCTCGAATCAACTTATTGGTCTTATGATATATCTCAGTATTGAGGATGATACCAAAGATCTGTATTTGTTTATAAACTCTCCTGGCGGATGGGTAATACCGGGGGTGTCTCTTTATGATACTATGCAATTTGT...

Protein

Download Protein FASTA

196 aa · TkAUNG004870|TK1151|PROTEIN

MPIGVPKVPFRSPGEEDATWVDIYNRLYRERLLFLGQEVDSEISNQLIGLMIYLSIEDDTKDLYLFINSPGGWVIPGVSLYDTMQFVQPDVQTICMGSAASMGSFILVGGEITKRLAFPHAWVMIHQPAGSFSEVATGEFILEVGELLKLRETLTRVYAQRTGKPLWVVSEDMERDVFMSATEAQAYGIVDLVAAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG004870`
TK1151 ID	TkAUNG004870
OH-1004 ID	LXL04_026528
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.900
Protein coverage (%)	TK1151 98.469 / OH-1004 67.368 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG004870`
Location	ChrUn:1465130-1467153 (+)
Description	Similar to CLPR2: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026528` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process GO:0009658 chloroplast organization Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009368 endopeptidase Clp complex Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0009840 chloroplastic endopeptidase Clp complex Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0004176 ATP-dependent peptidase activity Molecular Function GO:0004252 serine-type endopeptidase activity Molecular Function
KEGG gene cross-reference	ana:all4357 ath:AT1G12410 ava:Ava_1305 tel:tlr1071 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.635

Rank 1 · TkAUNG004870 · TK1151

Cytoplasm0.180

Rank 2 · TkAUNG004870 · TK1151

Mitochondrion0.160

Rank 3 · TkAUNG004870 · TK1151

Nucleus0.106

Rank 4 · TkAUNG004870 · TK1151

Peroxisome0.035

Rank 5 · TkAUNG004870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00574CLP_protease17-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG004870	`PF00574`	CLP_protease	17	194	9.8e-64	215.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card