TkAUNG003320 | RubberDandelionOmics

Gene overview

TkAUNG003320

Reference: TK1151 Chr: ChrUn Coordinates: 1010163-1014515 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2078 bp · TkAUNG003320|TK1151|cDNA

CCGGAAAAGGGTTGTGGAAAGGCACAAAAACCCTTTTTATCGGAGAAGGTGTATAAATATGGACACCAGATTCTATTCATCCCCAAAATCCCCTCTCCATTCAAGGAATAATTTCCTCCCACGCCTTCTTCATCTTTCCACAGCATTTCCGGCAACCGTCTCCTCTGCCGCCGTGGCCACCACCGCGCAAATATGGACCACGCTCCTAAATAAACTTATTCCTTTAATGTTTGAAGATTCTGATAGTTCCAGATTATAAA...

CDS

Download CDS FASTA

1446 bp · TkAUNG003320|TK1151|CDS

ATGAACGACGAAGCCCCCAAAAATGAAAAGGTTATAGAGATCGAAGATGGTGATGATCACGAGGACCAATCGTCTCCGAGAGGTGTGTTGGAAATCCCCGTATCAGGTTCGGATTCCGATAATCAGAGCAGCCTAAGCAGGAGCCTCAGCAGCCGCGGTTCGTCTTTCAATGATAAATCTCCGGATGGAGAAGTTGATTCGGCTACCGAGGAGGAAGGCAGCGGCGGAGCGGAGGTTGTCAACTCTTCGGCGACGGCTCA...

Protein

Download Protein FASTA

481 aa · TkAUNG003320|TK1151|PROTEIN

MNDEAPKNEKVIEIEDGDDHEDQSSPRGVLEIPVSGSDSDNQSSLSRSLSSRGSSFNDKSPDGEVDSATEEEGSGGAEVVNSSATAHGLQWRNLVDNLKWKSIKRLSALPLMAGYELSRKSLMKRLGKNQSIEDTIEGGNWAVPKPSWRNFTLEELATATDNFSSGNLVGRGGHADVYKGLLPDGQLVAVKRITKKEKKDEDRVGDFLSELGIIAHINHPNAARLIGFSSDTDLHLVLQFAPHGSLATLLHNSEERLEWG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG003320`
TK1151 ID	TkAUNG003320
OH-1004 ID	LXL04_014016
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 99.376 / OH-1004 98.755 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG003320

Location ChrUn:1010163-1014515 (-)

Description Similar to RBK1: Receptor-like cytosolic serine/threonine-protein kinase RBK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10520`	Receptor-like cytosolic serine/threonine-protein kinase RBK1.	No verified direct reference in this release
`At3g05140`	Receptor-like cytosolic serine/threonine-protein kinase RBK2.	No verified direct reference in this release
`At5g57670`	Probable receptor-like serine/threonine-protein kinase At5g57670.	No verified direct reference in this release
`At3g18810`	Putative proline-rich receptor-like protein kinase PERK6.	No verified direct reference in this release
`At1g52290`	Proline-rich receptor-like protein kinase PERK15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0048364 root development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G52290

ath:AT2G18470

ath:AT3G05140

ath:AT5G10520

ath:AT5G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.716

Rank 1 · TkAUNG003320 · TK1151

Nucleus0.223

Rank 2 · TkAUNG003320 · TK1151

Cytoplasm0.212

Rank 3 · TkAUNG003320 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkAUNG003320 · TK1151

Golgi apparatus0.026

Rank 5 · TkAUNG003320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03832WSK100-106 aa

PF00069Pkinase165-375 aa

PF07714PK_Tyr_Ser-Thr167-430 aa

PF03109ABC1175-194 aa

PF03109ABC1280-322 aa

PF17667Pkinase_fungal281-343 aa

PF03832WSK358-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG003320	`PF03832`	WSK	100	106	2.4	8.7
TkAUNG003320	`PF00069`	Pkinase	165	375	3.8e-39	135.4
TkAUNG003320	`PF07714`	PK_Tyr_Ser-Thr	167	430	9.2e-41	140.6
TkAUNG003320	`PF03109`	ABC1	175	194	0.0062	16.4
TkAUNG003320	`PF03109`	ABC1	280	322	0.0062	16.4
TkAUNG003320	`PF17667`	Pkinase_fungal	281	343	0.023	14.1
TkAUNG003320	`PF03832`	WSK	358	371	2.4	8.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1D6`	Arabidopsis thaliana	sp\|Q8H1D6\|RBK1_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK1	58.500%	Swiss-Prot	High
`Q8RXC8`	Arabidopsis thaliana	sp\|Q8RXC8\|RBK2_ARATH Receptor-like cytosolic serine/threonine-protein kinase RBK2	49.200%	Swiss-Prot	Medium
`Q5XF57`	Arabidopsis thaliana	sp\|Q5XF57\|Y5576_ARATH Probable receptor-like serine/threonine-protein kinase At5g57670	49.200%	Swiss-Prot	Medium
`Q9LS95`	Arabidopsis thaliana	sp\|Q9LS95\|PERK6_ARATH Putative proline-rich receptor-like protein kinase PERK6	40.100%	Swiss-Prot	Medium
`Q9C821`	Arabidopsis thaliana	sp\|Q9C821\|PEK15_ARATH Proline-rich receptor-like protein kinase PERK15	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card