TkAUNG003290 | RubberDandelionOmics

Gene overview

TkAUNG003290

Reference: TK1151 Chr: ChrUn Coordinates: 1002854-1007293 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2369 bp · TkAUNG003290|TK1151|cDNA

GTTTTTTCCCTCTGGTTTTCCGCCGGTGTGGCAGATGAAACCGACTCTTTCATCCCATTATATACCTCCACCTCTCCTCTCTTTCTTTCTCTTTCTTTAACATTCAAGAACAGTCAATACAACTACCCCTGCCTGTGCCGGTGCCGGAAAGATAGCTTCTGCATGTGCTCCCTTCAACACCAATCTTCTCCTTTTTCCATTCTTGGCCTCCGCCATCAAATTCTTAGCACTTTAGTCCACTTCTAAGCCTTCATTGGTAA...

CDS

Download CDS FASTA

1548 bp · TkAUNG003290|TK1151|CDS

ATGGCTCCGGATAATAACTGGCTCTCTTTTTCACTCTCGCCGATGGAGATGTTCACTTCTTCTACCTCTCAGCCTCAGCAGTTTTACTTCAACGATAATTTCTATGCAAATGGTTGGGCTAACGGTGGAAAGACCTCAACGATGTATACAGGAGACAACAGCAATACTCACGGCGATGTCAAAGACGGCGGCGATTCACCGCTTTTCCGAAGCTTCATGGAGTCTCATATCAACCAGCAACAAGCTCCCAAGCTGGAAGA...

Protein

Download Protein FASTA

515 aa · TkAUNG003290|TK1151|PROTEIN

MAPDNNWLSFSLSPMEMFTSSTSQPQQFYFNDNFYANGWANGGKTSTMYTGDNSNTHGDVKDGGDSPLFRSFMESHINQQQAPKLEDFLGGDTTPTPVTTTHSMQSFRYTDVSQTETQDSSSLTHMYDGNSSVYFSDHQDLNGLAGTTGFQTFSTNSGSEVDDSGTHLTEFAGQSMESGNELAYVQCPMNALSLGITTQQSSDQNQKAVVAADSGDQNNCKKIGDTFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG003290`
TK1151 ID	TkAUNG003290
OH-1004 ID	LXL04_014015
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 99.806 / OH-1004 90.223 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG003290

Location ChrUn:1002854-1007293 (+)

Description Similar to AIL6: AP2-like ethylene-responsive transcription factor AIL6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10510`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g65510`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g20840`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g57390`	Probably acts as a transcriptional activator.	AINTEGUMENTA-like (AIL) genes are expressed in young tissues and may specify meristematic or division-competent states.2005 · DOI: 10.1007/s11103-005-0955-6

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014015 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009845 seed germination Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010080 regulation of floral meristem growth Biological Process

KEGG gene cross-reference

ath:AT1G51190

ath:AT5G10510

ath:AT5G57390

ath:AT5G65510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkAUNG003290 · TK1151

Cytoplasm0.075

Rank 2 · TkAUNG003290 · TK1151

Cell membrane0.029

Rank 3 · TkAUNG003290 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkAUNG003290 · TK1151

Plastid0.017

Rank 5 · TkAUNG003290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19947DUF640934-64 aa

PF00847AP2234-288 aa

PF19947DUF6409298-342 aa

PF00847AP2333-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG003290	`PF19947`	DUF6409	34	64	0.17	12.7
TkAUNG003290	`PF00847`	AP2	234	288	3.9e-18	66.2
TkAUNG003290	`PF19947`	DUF6409	298	342	0.17	12.7
TkAUNG003290	`PF00847`	AP2	333	383	3.9e-18	66.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q52QU2`	Arabidopsis thaliana	sp\|Q52QU2\|AIL6_ARATH AP2-like ethylene-responsive transcription factor AIL6	57.600%	Swiss-Prot	High
`Q6J9N8`	Arabidopsis thaliana	sp\|Q6J9N8\|AIL7_ARATH AP2-like ethylene-responsive transcription factor AIL7	47.900%	Swiss-Prot	Medium
`Q5YGP7`	Arabidopsis thaliana	sp\|Q5YGP7\|PLET2_ARATH AP2-like ethylene-responsive transcription factor PLT2	68.800%	Swiss-Prot	Low
`Q5YGP8`	Arabidopsis thaliana	sp\|Q5YGP8\|PLET1_ARATH AP2-like ethylene-responsive transcription factor PLT1	74.000%	Swiss-Prot	Low
`Q6PQQ3`	Arabidopsis thaliana	sp\|Q6PQQ3\|AIL5_ARATH AP2-like ethylene-responsive transcription factor AIL5	71.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card