TkAUNG002390 | RubberDandelionOmics

Gene overview

TkAUNG002390

Reference: TK1151 Chr: ChrUn Coordinates: 735427-747337 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1792 bp · TkAUNG002390|TK1151|cDNA

GGCCCAAGCCGCATAGGTATTGGGCCGGCCCTGCCATGTATATAATATCCTCTGCAAAATAAATAAAAGAAAAAAAAATATGCATGATGATTTAATCGAAATTTAATAAATAAAACTAGAATAAACTAAATAAAATAAGGAAATAAAGTTCACTCCTCAAAAATCACACAGAAATGTTAAGTAAACTTATATAAAAATTGAACTGTAAAATGCCAAGTTAACCAACCCAGCAGAAATTACATCGACAACTTAAAGGTCGC...

CDS

Download CDS FASTA

1047 bp · TkAUNG002390|TK1151|CDS

ATGGACGGGAGGGTCCCGAAACCCCGAGTCGACCCCGGGATCATATTCCGTGTTTCCGAGCAATTCCTCCGCCGCCAGCATTACGCCGATTGTCGTGACTATGTTCGACAAGTATTCGAAATCGACCCTAATTATCCCGGCGTTTCCGAGATCCTCGCCGTTGCCGATGTTTTGCTTGCCTCCAAGACTCGACTCTCGACCGAAATTCCGCATGACTGGTACGCCGTCTTGCAACTCGATCGATTTTCACAAGACTCGGA...

Protein

Download Protein FASTA

348 aa · TkAUNG002390|TK1151|PROTEIN

MDGRVPKPRVDPGIIFRVSEQFLRRQHYADCRDYVRQVFEIDPNYPGVSEILAVADVLLASKTRLSTEIPHDWYAVLQLDRFSQDSELIKHRFDHLYRLLDPSNNKFPFADKAFDLVCEAWFVLSNPEQKLEFDESLKDDEKSKDTSVIAFWTVCPYCYHVYEFPRVYLEHFLMCPNEKCSKAFTCVEIDQPPVLVVNAGKYICAGFSPLGFPYGNWNPFAPLKKQEAKTSPNIDSFVEISDDDEVEINRDKDVRDKGVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG002390`
TK1151 ID	TkAUNG002390
OH-1004 ID	LXL04_014001
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG002390

Location ChrUn:735427-747337 (+)

Description Similar to At4g38065: Uncharacterized protein At4g38065

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68810`	Transcription factor bHLH30.	No verified direct reference in this release
`At2g41130`	Transcription factor bHLH106.	No verified direct reference in this release
`At3g25710`	Transcription factor required for MONOPTEROS-dependent root initiation in embryo.	MONOPTEROS controls embryonic root initiation by regulating a mobile transcription factor.2010 · DOI: 10.1038/nature08836
`At4g38070`	Transcription factor bHLH131.	No verified direct reference in this release
`At3g56770`	Putative transcription factor bHLH107.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014001 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G38065

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.852

Rank 1 · TkAUNG002390 · TK1151

Cytoplasm0.168

Rank 2 · TkAUNG002390 · TK1151

Cell membrane0.042

Rank 3 · TkAUNG002390 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkAUNG002390 · TK1151

Plastid0.018

Rank 5 · TkAUNG002390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25063ARM_TT21_C11-53 aa

PF00226DnaJ72-134 aa

PF23551Zn_ribbon_20151-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG002390	`PF25063`	ARM_TT21_C	11	53	0.28	11.8
TkAUNG002390	`PF00226`	DnaJ	72	134	7.2e-09	36.3
TkAUNG002390	`PF23551`	Zn_ribbon_20	151	187	2e-06	28.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7Y1`	Arabidopsis thaliana	sp\|Q9S7Y1\|BH030_ARATH Transcription factor bHLH30	41.800%	Swiss-Prot	Medium
`O80674`	Arabidopsis thaliana	sp\|O80674\|BH106_ARATH Transcription factor bHLH106	41.900%	Swiss-Prot	Medium
`Q9LS08`	Arabidopsis thaliana	sp\|Q9LS08\|BH032_ARATH Transcription factor AIG1	42.900%	Swiss-Prot	Medium
`P0CB25`	Arabidopsis thaliana	sp\|P0CB25\|BH131_ARATH Transcription factor bHLH131	38.200%	Swiss-Prot	Medium
`Q9LET0`	Arabidopsis thaliana	sp\|Q9LET0\|BH107_ARATH Putative transcription factor bHLH107	41.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card