TkAUNG002110 | RubberDandelionOmics

Gene overview

TkAUNG002110

Reference: TK1151 Chr: ChrUn Coordinates: 646987-649854 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · TkAUNG002110|TK1151|cDNA

CTGTACTTCATTCATTCATTCATTGGGGATTGGGAGTTGCAAATTGCTTTCGTTGCTCCGTACGTCCCCGTTGCTTACGACAAATTTATTTGACTCTCTGCGGAAATCAAGAAAAAACACAGACTTAACACAGAAAGTTAGGGAAAAGCAGAAGAACTGAAGCTGGATATATGAATGGACAAAAGTGGGCATACACCCCTGTATGCCTTTAAAGATCTGGAGAAAAACAGCTAACTGATATGGGTGTTTCAAGAGCCATG...

CDS

Download CDS FASTA

768 bp · TkAUNG002110|TK1151|CDS

ATGGCTGATGTCGATGTGCCAACTTTAGATACAACAAAGCAAATGCAAATAATTCCTCGGCCTCCTGTGCCAAGTATAGAAGTGTGTCCTGTTAGTAGTCCATCATCTAATGGATCTTCAGTTAAACCGCGTATGCGTTGGACTCCAGAACTTCATGAATCTTTTGTTGAAGCAGTCAACCAGCTTGGTGGTAGTGAACGGGCTACACCTAAAGGAGTTTTGAAGCTCATGAATATTGAAAGTTTGACAATTTATCATGT...

Protein

Download Protein FASTA

255 aa · TkAUNG002110|TK1151|PROTEIN

MADVDVPTLDTTKQMQIIPRPPVPSIEVCPVSSPSSNGSSVKPRMRWTPELHESFVEAVNQLGGSERATPKGVLKLMNIESLTIYHVKSHLQKYRTARYKPELSEGTSEKKPTSLDDMVSLDKTKSLGFTDALKLQMEVQKQLHEQLEIQRNLQLRIEEQGKYLQLMFEQQRKLENGRVKPSSSNQDQDPETEKLKALKSDDPCVSDKDSEKSKEKEKEKSTSQIEVNISNIDSGCSPRASKRARPDEASSSSVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG002110`
TK1151 ID	TkAUNG002110
OH-1004 ID	LXL04_035670
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 64.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG002110

Location ChrUn:646987-649854 (-)

Description Similar to PHR1: Protein PHOSPHATE STARVATION RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28610`	Transcription factor involved in phosphate starvation signaling.	The Arabidopsis transcription factor PHR1 is essential for adaptation to high light and retaining functional photosynthesis during phosphate starvation.2012 · DOI: 10.1111/j.1399-3054.2011.01520.x
`At5g29000`	Transcription factor acting as central integrator of phosphate starvation responses.	A central regulatory system largely controls transcriptional activation and repression responses to phosphate starvation in Arabidopsis.2010 · DOI: 10.1371/journal.pgen.1001102 Arabidopsis ferritin 1 (AtFer1) gene regulation by the phosphate starvation response 1 (AtPHR1) transcription factor reveals a direct molecular link between iron and phosphate homeostasis.2013 · DOI: 10.1074/jbc.m113.482281
`At3g04450`	Myb family transcription factor PHL13.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B5N8`	Transcription factor involved in phosphate starvation signaling (By similarity).	No verified direct reference in this release
`Os07g0438800`	Transcription factor involved in phosphate starvation signaling.	OsPHR2 is involved in phosphate-starvation signaling and excessive phosphate accumulation in shoots of plants.2008 · DOI: 10.1104/pp.107.111443 Role of OsPHR2 on phosphorus homeostasis and root hairs development in rice (Oryza sativa L.).2008 · DOI: 10.4161/psb.3.9.5781 OsSPX1 suppresses the function of OsPHR2 in the regulation of expression of OsPT2 and phosphate homeostasis in shoots of rice.2010 · DOI: 10.1111/j.1365-313x.2010.04170.x SPX4 Negatively Regulates Phosphate Signaling and Homeostasis through Its Interaction with PHR2 in Rice.2014 · DOI: 10.1105/tpc.114.123208 Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner.2014 · DOI: 10.1073/pnas.1404680111 Genetic manipulation of a high-affinity PHR1 target cis-element to improve phosphorous uptake in Oryza sativa L.2015 · DOI: 10.1007/s11103-015-0289-y Integrative Comparison of the Role of the PHOSPHATE RESPONSE1 Subfamily in Phosphate Signaling and Homeostasis in Rice.2015 · DOI: 10.1104/pp.15.00736 Modulation of nitrate-induced phosphate response by the MYB transcription factor RLI1/HINGE1 in the nucleus.2021 · DOI: 10.1016/j.molp.2020.12.005

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035670 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0034765 regulation of monoatomic ion transmembrane transport Biological Process

GO:0048364 root development Biological Process

GO:0055063 sulfate ion homeostasis Biological Process

GO:0071486 cellular response to high light intensity Biological Process

GO:1901000 regulation of response to salt stress Biological Process

GO:1903842 response to arsenite ion Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G04450

ath:AT4G28610

ath:AT5G29000

dosa:Os03g0329900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkAUNG002110 · TK1151

Cytoplasm0.115

Rank 2 · TkAUNG002110 · TK1151

Cell membrane0.016

Rank 3 · TkAUNG002110 · TK1151

Mitochondrion0.013

Rank 4 · TkAUNG002110 · TK1151

Endoplasmic reticulum0.006

Rank 5 · TkAUNG002110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding44-95 aa

PF29175YDR381CA71-113 aa

PF14379Myb_CC_LHEQLE129-173 aa

PF29175YDR381CA211-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG002110	`PF00249`	Myb_DNA-binding	44	95	5.7e-10	39.9
TkAUNG002110	`PF29175`	YDR381CA	71	113	0.073	14.0
TkAUNG002110	`PF14379`	Myb_CC_LHEQLE	129	173	3.7e-21	75.3
TkAUNG002110	`PF29175`	YDR381CA	211	236	0.073	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CL7`	Arabidopsis thaliana	sp\|Q94CL7\|PHR1_ARATH Protein PHOSPHATE STARVATION RESPONSE 1	71.400%	Swiss-Prot	Medium
`Q8GUN5`	Arabidopsis thaliana	sp\|Q8GUN5\|PHL1_ARATH Protein PHR1-LIKE 1	55.100%	Swiss-Prot	High
`F4J3P7`	Arabidopsis thaliana	sp\|F4J3P7\|PHLD_ARATH Myb family transcription factor PHL13	56.400%	Swiss-Prot	Medium
`B8B5N8`	Oryza sativa subsp. indica	sp\|B8B5N8\|PHR2_ORYSI Protein PHOSPHATE STARVATION RESPONSE 2	68.500%	Swiss-Prot	Medium
`Q6Z156`	Oryza sativa subsp. japonica	sp\|Q6Z156\|PHR2_ORYSJ Protein PHOSPHATE STARVATION RESPONSE 2	68.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card