RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG001940
Reference: TK1151 Chr: ChrUn Coordinates: 565455-566539 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

879 bp · TkAUNG001940|TK1151|cDNA

ACCCAAAAACGAAGATTCCGCAGATGTAGAAGTGCTCCTTTAGCTGAATTTATTCCTGGGGAAATCAATGCTACCAATGAAGCTCAAACGCTTCCGCGTTCAGTATCCCTTTTAGATCAAATACATCCCAGTTTCAGAAGGGTAGCAATTTACTTGATCTTCTACTTAGCTATTGGTACCGTTTGCTTTTATTTTGTTAGAGATCAGATCAAGGGTGATAAAGTAAACGGCGTTCTTGATTCTGTTTACTTTTGCATTGT...

CDS

Download CDS FASTA

879 bp · TkAUNG001940|TK1151|CDS

ACCCAAAAACGAAGATTCCGCAGATGTAGAAGTGCTCCTTTAGCTGAATTTATTCCTGGGGAAATCAATGCTACCAATGAAGCTCAAACGCTTCCGCGTTCAGTATCCCTTTTAGATCAAATACATCCCAGTTTCAGAAGGGTAGCAATTTACTTGATCTTCTACTTAGCTATTGGTACCGTTTGCTTTTATTTTGTTAGAGATCAGATCAAGGGTGATAAAGTAAACGGCGTTCTTGATTCTGTTTACTTTTGCATTGT...

Protein

Download Protein FASTA

292 aa · TkAUNG001940|TK1151|PROTEIN

TQKRRFRRCRSAPLAEFIPGEINATNEAQTLPRSVSLLDQIHPSFRRVAIYLIFYLAIGTVCFYFVRDQIKGDKVNGVLDSVYFCIVTMTTVGYGDLVPNSAPTKLLACAFVFSGMVLVGLMVSKGADYLVEKQEILLIKALHMDQKLGTTDILQELENNKVRYKCFVAMGLLVVLFLSGTVFLATVEKLDVVDALYCFLCYVAELNTESRQKALVKYVLTKKMTNIDLEAADIDDNGIVGAAEFIIYKLKEMGKINQED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG001940
TK1151 IDTkAUNG001940
OH-1004 IDLXL04_031029
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)47.400
Protein coverage (%)TK1151 98.630 / OH-1004 88.705
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG001940
LocationChrUn:565455-566539 (-)
DescriptionSimilar to TPK1: Two-pore potassium channel 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g55630 Voltage-independent, large conductance and potassium- selective tonoplast ion channel.
TPK1 is a vacuolar ion channel different from the slow-vacuolar cation channel.2005 · DOI: 10.1104/pp.105.065599
TPK1, a Ca(2+)-regulated Arabidopsis vacuole two-pore K(+) channel is activated by 14-3-3 proteins.2007 · DOI: 10.1111/j.1365-313x.2007.03255.x
At4g01840 Probable voltage-independent potassium-selective tonoplast ion channel. No verified direct reference in this release
At5g46370 Probable voltage-independent potassium-selective tonoplast ion channel. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0752300 Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of large vacuoles.
Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
Os07g0108800 Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of protein storage vacuoles.
Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031029 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010027 thylakoid membrane organization Biological Process
GO:0010029 regulation of seed germination Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010196 nonphotochemical quenching Biological Process
GO:0030007 intracellular potassium ion homeostasis Biological Process
GO:0071257 cellular response to electrical stimulus Biological Process
GO:0071805 potassium ion transmembrane transport Biological Process
GO:0097623 potassium ion export across plasma membrane Biological Process
GO:1990573 potassium ion import across plasma membrane Biological Process
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT4G01840
ath:AT4G18160
ath:AT5G55630
dosa:Os03g0752300
dosa:Os07g0108800
osa:4334137
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.332
Rank 1 · TkAUNG001940 · TK1151
Cell membrane0.310
Rank 2 · TkAUNG001940 · TK1151
Endoplasmic reticulum0.163
Rank 3 · TkAUNG001940 · TK1151
Cytoplasm0.144
Rank 4 · TkAUNG001940 · TK1151
Golgi apparatus0.122
Rank 5 · TkAUNG001940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07885Ion_trans_250-131 aa
PF00520Ion_trans52-123 aa
PF00520Ion_trans170-178 aa
PF07885Ion_trans_2172-200 aa
PF00404Dockerin_1215-245 aa
PF13833EF-hand_8217-246 aa
PF13202EF-hand_5228-245 aa
PF13499EF-hand_7229-247 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG001940PF07885Ion_trans_2501315.7e-1865.3
TkAUNG001940PF00520Ion_trans521234.2e-0626.8
TkAUNG001940PF00520Ion_trans1701784.2e-0626.8
TkAUNG001940PF07885Ion_trans_21722005.7e-1865.3
TkAUNG001940PF00404Dockerin_12152450.006917.3
TkAUNG001940PF13833EF-hand_82172460.02215.2
TkAUNG001940PF13202EF-hand_52282450.0813.2
TkAUNG001940PF13499EF-hand_72292470.005917.6
TkAUNG001940PF00036EF-hand_12312460.03714.3
TkAUNG001940PF13405EF-hand_62322460.07113.6
TkAUNG001940PF21698Spo16_C2462710.113.0
TkAUNG001940PF13833EF-hand_82542660.02215.2
TkAUNG001940PF13499EF-hand_72632880.005917.6
TkAUNG001940PF13405EF-hand_62652840.07113.6
TkAUNG001940PF00036EF-hand_12662830.03714.3
TkAUNG001940PF13202EF-hand_52662830.0813.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LBL1Arabidopsis thalianasp|Q8LBL1|KCO1_ARATH Two-pore potassium channel 153.200%Swiss-ProtHigh
Q9S6Z8Arabidopsis thalianasp|Q9S6Z8|KCO5_ARATH Two-pore potassium channel 529.700%Swiss-ProtLow
Q9FL25Arabidopsis thalianasp|Q9FL25|KCO2_ARATH Two-pore potassium channel 228.000%Swiss-ProtLow
Q850M0Oryza sativa subsp. japonicasp|Q850M0|KCO1_ORYSJ Two pore potassium channel a51.900%Swiss-ProtHigh
Q8LIN5Oryza sativa subsp. japonicasp|Q8LIN5|KCO2_ORYSJ Two pore potassium channel b49.100%Swiss-ProtMedium

JBrowse

View in Genome Browser