TkA08G435540 | RubberDandelionOmics

Gene overview

TkA08G435540

Reference: TK1151 Chr: Chr08 Coordinates: 110733803-110736522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2199 bp · TkA08G435540|TK1151|cDNA

ATGGCTGAGATCTCAGAGCTTCAGGTAAATAAACTCCAATTCGTTAAAGATCGGAAGAAGATTAAGAAAGACAACAAAGGGACTCTGCCTGAAATTGTTCTTCGGGAAATTCCTGCTGATGTACAGGAAAGAATAGAAGCCATCGTAACAAAGAAACCTCAAGCTAAGAGAAAGAAGGGCGACGTGATTGAAACCGAACAAGTTCAACCCAAACATGAACAAACTCCTCCCCGAAAGAAAAAGAAAACAGATGAAGCTAC...

CDS

Download CDS FASTA

2199 bp · TkA08G435540|TK1151|CDS

ATGGCTGAGATCTCAGAGCTTCAGGTAAATAAACTCCAATTCGTTAAAGATCGGAAGAAGATTAAGAAAGACAACAAAGGGACTCTGCCTGAAATTGTTCTTCGGGAAATTCCTGCTGATGTACAGGAAAGAATAGAAGCCATCGTAACAAAGAAACCTCAAGCTAAGAGAAAGAAGGGCGACGTGATTGAAACCGAACAAGTTCAACCCAAACATGAACAAACTCCTCCCCGAAAGAAAAAGAAAACAGATGAAGCTAC...

Protein

Download Protein FASTA

732 aa · TkA08G435540|TK1151|PROTEIN

MAEISELQVNKLQFVKDRKKIKKDNKGTLPEIVLREIPADVQERIEAIVTKKPQAKRKKGDVIETEQVQPKHEQTPPRKKKKTDEATQSNASHYSEPEQQPEQEQTKTPPKQPEKDTTFDNLENIEKLTQTPPVPPEQTEQEDNTNKPSPHQSESEPVDEEINMEGPRADLFNPNQATSSTYVKPTDMFTFLPVSFEEENLTSEQQHLSATKKDISSLRTMLNTILVGIDPSSESKKDDLAKKQSEEFKEIRKELLTSID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G435540`
TK1151 ID	TkA08G435540
OH-1004 ID	LXL04_023605
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	73.300
Protein coverage (%)	TK1151 100.000 / OH-1004 84.593 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G435540`
Location	Chr08:110733803-110736522 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023605` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.820

Rank 1 · TkA08G435540 · TK1151

Cytoplasm0.245

Rank 2 · TkA08G435540 · TK1151

Mitochondrion0.031

Rank 3 · TkA08G435540 · TK1151

Cell membrane0.027

Rank 4 · TkA08G435540 · TK1151

Extracellular0.014

Rank 5 · TkA08G435540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04513Baculo_PEP_C215-277 aa

PF04899MbeD_MobD250-310 aa

PF07889DUF1664254-310 aa

PF25561QRICH1276-315 aa

PF04513Baculo_PEP_C288-355 aa

PF25561QRICH1321-342 aa

PF04899MbeD_MobD326-355 aa

PF25561QRICH1592-625 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G435540	`PF04513`	Baculo_PEP_C	215	277	3.4	8.4
TkA08G435540	`PF04899`	MbeD_MobD	250	310	0.034	15.0
TkA08G435540	`PF07889`	DUF1664	254	310	10.0	6.9
TkA08G435540	`PF25561`	QRICH1	276	315	2.2	9.1
TkA08G435540	`PF04513`	Baculo_PEP_C	288	355	3.4	8.4
TkA08G435540	`PF25561`	QRICH1	321	342	2.2	9.1
TkA08G435540	`PF04899`	MbeD_MobD	326	355	0.034	15.0
TkA08G435540	`PF25561`	QRICH1	592	625	2.2	9.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card