Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2005 bp · TkA08G434430|TK1151|cDNA
AAGAAGCGTAAATACGATGTTGTAAAGGCTAAATTCGCGCCTAAATGTATAAAAATGTCGCATAAGCCGACATGCAAGGCGCAAAACATGGGTTTTCAAAATTCAGAAACATTCTCTCAAAACCCCCCCAAATGTTGATCCAACACCCCCAAAGAAAAACCTCAATCGTCAAATTGTAAATTGTATGATTTGCAGATAGCTATGGAGATTGTCTCTACCTCAATTGCTTCTTGTCCAAAGGAGCATCGGAAAGTCTATCA...
1632 bp · TkA08G434430|TK1151|CDS
ATGGAGATTGTCTCTACCTCAATTGCTTCTTGTCCAAAGGAGCATCGGAAAGTCTATCAACAATGGTTCGACTACATCGATTCAGATGATGATGGTAGGATAACAGGAATGGAAGCATCAGAGTTTTTGGCTATGTCAAAGTTACCAAAGCATGACCTTAAACAAGTTTGGGCCATTGCAGATTCTAAGCGGCAAGGGTTTCTAGGTTTTAAAGAGTTCATCACTGCTATGCAGTTGGTGAGTCTGGCACAAGCAGGAAA...
Protein
Download Protein FASTA543 aa · TkA08G434430|TK1151|PROTEIN
MEIVSTSIASCPKEHRKVYQQWFDYIDSDDDGRITGMEASEFLAMSKLPKHDLKQVWAIADSKRQGFLGFKEFITAMQLVSLAQAGNDLSVDLLRTTDVEGLELPSIEGLGQFLSKRNASRNDAVAESNGTPPFSSIPKLNTLFSSKSTKKPVNDVTSIVDGLKKLYNEKLKPLEITYQYSDFASPLLTDSDFDAKPMVMLLGQYSTGKTTFIRHILKSNYPGAHIGPEPTTDKFIVVMNGADERSIPGNTVAIRPDMPF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G434430 |
|---|---|
| TK1151 ID | TkA08G434430 |
| OH-1004 ID | LXL04_027019 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 72.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G434430 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:110413117-110417599 (-) | |||||||||
| Description | Similar to EHD1: EH domain-containing protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006897 endocytosis Biological Process GO:0006907 pinocytosis Biological Process GO:0010886 positive regulation of cholesterol storage Biological Process GO:0016197 endosomal transport Biological Process GO:0030100 regulation of endocytosis Biological Process GO:0032456 endocytic recycling Biological Process GO:0032956 regulation of actin cytoskeleton organization Biological Process GO:0034383 low-density lipoprotein particle clearance Biological Process GO:0042538 hyperosmotic salinity response Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G20290 ath:AT4G05520 hsa:30844 mmu:98878 rno:293692 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23564EF-hand_FSTL112-45 aaPF12763EH15-91 aaPF13499EF-hand_720-78 aaPF00036EF-hand_120-43 aaPF13405EF-hand_620-43 aaPF13202EF-hand_520-38 aaPF13833EF-hand_823-43 aaPF00036EF-hand_152-78 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G434430 | PF23564 | EF-hand_FSTL1 | 12 | 45 | 0.082 | 14.0 |
| TkA08G434430 | PF12763 | EH | 15 | 91 | 4.2e-13 | 49.8 |
| TkA08G434430 | PF13499 | EF-hand_7 | 20 | 78 | 4.3e-06 | 27.7 |
| TkA08G434430 | PF00036 | EF-hand_1 | 20 | 43 | 3.9e-05 | 23.6 |
| TkA08G434430 | PF13405 | EF-hand_6 | 20 | 43 | 4.4e-05 | 23.6 |
| TkA08G434430 | PF13202 | EF-hand_5 | 20 | 38 | 0.043 | 14.1 |
| TkA08G434430 | PF13833 | EF-hand_8 | 23 | 43 | 0.053 | 14.0 |
| TkA08G434430 | PF00036 | EF-hand_1 | 52 | 78 | 3.9e-05 | 23.6 |
| TkA08G434430 | PF13405 | EF-hand_6 | 52 | 78 | 4.4e-05 | 23.6 |
| TkA08G434430 | PF23564 | EF-hand_FSTL1 | 52 | 78 | 0.082 | 14.0 |
| TkA08G434430 | PF13833 | EF-hand_8 | 59 | 78 | 0.053 | 14.0 |
| TkA08G434430 | PF13202 | EF-hand_5 | 63 | 75 | 0.043 | 14.1 |
| TkA08G434430 | PF16880 | EHD_N | 162 | 194 | 6.5e-16 | 58.7 |
| TkA08G434430 | PF02367 | TsaE | 194 | 219 | 0.11 | 13.2 |
| TkA08G434430 | PF13191 | AAA_16 | 196 | 219 | 0.098 | 13.9 |
| TkA08G434430 | PF00350 | Dynamin_N | 199 | 359 | 4e-13 | 50.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.