TkA08G433500 | RubberDandelionOmics

Gene overview

TkA08G433500

Reference: TK1151 Chr: Chr08 Coordinates: 110197235-110199925 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1370 bp · TkA08G433500|TK1151|cDNA

CCCGAATCGAGATTTTGACTGCCTTCGAAACAAACCCTAACGCCTTCCCTCCGCCCTCAGTTTATCCCACACGCGCATATTTCTTGTGTCTGCGTCTCTCTAGTCTCTACTGAGCGTGAACTCACGAACAGCAATTTCCCAACTGCATTCGTCTCGACTCTCTCTCTCTCTATTAACCTCTCTGCCATCGCATCCTAAGTATCAAGTTATTAGCTAAGCAAACGGGGATTAGGGTAATGGCTGAAGAAGTTCAAACGCAA...

CDS

Download CDS FASTA

960 bp · TkA08G433500|TK1151|CDS

ATGGCTGAAGAAGTTCAAACGCAAGAAGCTGGAAAAGGCCCAAGGAAGAGAAACATAGGTCACAAGAAGGGTAAGGGGAAGAAGAAAATGAAAGTCTTTCATGGAAGTGGTCAACAGAAGGCTAAAATGGATGGAAAAACAAAAAAGCTTTTCCGGAAAAGGGCAAGAGATTACAATTCCGATGATAGTGAGGATGATGTTAATGATATAGATGATGAAGAAGAGTCTGCCCCTCCAATGGAGTTTCAAAAAGAGCAGGT...

Protein

Download Protein FASTA

319 aa · TkA08G433500|TK1151|PROTEIN

MAEEVQTQEAGKGPRKRNIGHKKGKGKKKMKVFHGSGQQKAKMDGKTKKLFRKRARDYNSDDSEDDVNDIDDEEESAPPMEFQKEQVNDVNEEEDEKSSEEEAEEEMDEDVDVSNEVSDDEDGEIQPGIMKFFEGNTSFKKAFKKIVKRSGTDDVLGPVLSAYKKLVVKKLAEEVDERKVKGDAKKEKTLLGEKGHVKPDTFSVPHEKLLIGVATKGVVKLFNAVNKAQSSQKGFNPSRSKDAKVIQKRRKEAFFSELGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G433500`
TK1151 ID	TkA08G433500
OH-1004 ID	LXL04_034751
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G433500`
Location	Chr08:110197235-110199925 (+)
Description	Similar to RRP15: RRP15-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034751` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000460 maturation of 5.8S rRNA Biological Process GO:0000470 maturation of LSU-rRNA Biological Process GO:0030687 preribosome, large subunit precursor Cellular Component
KEGG gene cross-reference	hsa:51018 mmu:67223 rno:360895 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA08G433500 · TK1151

Cytoplasm0.112

Rank 2 · TkA08G433500 · TK1151

Mitochondrion0.015

Rank 3 · TkA08G433500 · TK1151

Cell membrane0.012

Rank 4 · TkA08G433500 · TK1151

Extracellular0.009

Rank 5 · TkA08G433500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10846DUF272216-123 aa

PF07890Rrp15p76-76 aa

PF25041UFL1_C80-109 aa

PF07890Rrp15p139-258 aa

PF25041UFL1_C159-186 aa

PF25041UFL1_C217-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G433500	`PF10846`	DUF2722	16	123	1.6	8.6
TkA08G433500	`PF07890`	Rrp15p	76	76	1.5e-19	71.3
TkA08G433500	`PF25041`	UFL1_C	80	109	9.8	6.7
TkA08G433500	`PF07890`	Rrp15p	139	258	1.5e-19	71.3
TkA08G433500	`PF25041`	UFL1_C	159	186	9.8	6.7
TkA08G433500	`PF25041`	UFL1_C	217	239	9.8	6.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card