TkA08G431890 | RubberDandelionOmics

Gene overview

TkA08G431890

Reference: TK1151 Chr: Chr08 Coordinates: 109793639-109796636 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2259 bp · TkA08G431890|TK1151|cDNA

GAAGCCGCCAAGACGATTACCGGATCAACCGGTCAACGCATTGAAGAAAAGGTGAAAAGAGCAAAACGGTCGACTTCTTTCTTCGGTATAAACACGAGAAATATGGATTAGGGTTTTCTTCGGCTCAAATTGAAGATTTACGAAAGCAGAGAAGGGAGAACGATCTCAAAACTACGTGTTTCTCTCTCTTCATTGACTTAATTTAAAAGCTTGATTTGAAGGCTATTTATCTGATTTTTCTCCAAATCAAGGAATTTTTG...

CDS

Download CDS FASTA

1689 bp · TkA08G431890|TK1151|CDS

ATGTTGCCGCCACGTCAGCAACCAAAGTCCGGATCCCTCCACACATCTCTAACCCTAGTTCCAGGCGAACCCTGCGGATCTCCCAACATCCAAGAACGCGGCTCAAACTCAGACCAAATCCGCGACTCACCAACCGAAAGCGCAAGCTCGCGTGAAACCTGGCCCACACCGGACCCACTAACACTACCCAAACCCCTAGACAACACGTCAGCAGAACATTCCGTGATCCGCCACATCACCGACAAAATGTCCCTCCGAGA...

Protein

Download Protein FASTA

562 aa · TkA08G431890|TK1151|PROTEIN

MLPPRQQPKSGSLHTSLTLVPGEPCGSPNIQERGSNSDQIRDSPTESASSRETWPTPDPLTLPKPLDNTSAEHSVIRHITDKMSLRDISRERVDIIAERMHHLPNEFLEKLKNELRGLIEGMGGHQHREEYIFLQKMVLARSDLTEKTLVVAHRGQLEILVAIKTGIQAFLHPTVSLSQSSLIEIFLYKRCRNIACGNQIPADNCTCEICIKRNGFCNLCMCVICSKFDFEVNTCRWIGCDVCSHWTHTDCAIHNAQIGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G431890`
TK1151 ID	TkA08G431890
OH-1004 ID	LXL04_034742
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G431890

Location Chr08:109793639-109796636 (-)

Description Similar to PVIP: OBERON-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48160`	Probable transcription factor that acts together with OBE1 for the maintenance and/or establishment of both the shoot and root meristems, probably by controlling the expression of the meristem genes such as WUS, PLT1 and PLT2 and of genes required for auxin responses.	The Arabidopsis OBERON1 and OBERON2 genes encode plant homeodomain finger proteins and are required for apical meristem maintenance.2008 · DOI: 10.1242/dev.014993 Arabidopsis plant homeodomain finger proteins operate downstream of auxin accumulation in specifying the vasculature and primary root meristem.2009 · DOI: 10.1111/j.1365-313x.2009.03874.x
`At3g07780`	Probable transcription factor that acts together with OBE2 for the maintenance and/or establishment of both the shoot and root meristems, probably by controlling the expression of the meristem genes such as WUS, PLT1 and PLT2 and of genes required for auxin responses.	The Arabidopsis OBERON1 and OBERON2 genes encode plant homeodomain finger proteins and are required for apical meristem maintenance.2008 · DOI: 10.1242/dev.014993 Arabidopsis plant homeodomain finger proteins operate downstream of auxin accumulation in specifying the vasculature and primary root meristem.2009 · DOI: 10.1111/j.1365-313x.2009.03874.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0239200`	Probable transcription factor that functions as a regulator of metal transporter genes responsible for essential metals delivery to shoots and normal plant growth.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034742 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010071 root meristem specification Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0046740 transport of virus in host, cell to cell Biological Process

GO:0080022 primary root development Biological Process

GO:0098659 inorganic cation import across plasma membrane Biological Process

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G07780

ath:AT5G48160

dosa:Os03g0239200

osa:4332199

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · TkA08G431890 · TK1151

Cytoplasm0.096

Rank 2 · TkA08G431890 · TK1151

Cell membrane0.032

Rank 3 · TkA08G431890 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G431890 · TK1151

Plastid0.012

Rank 5 · TkA08G431890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16312Oberon_cc134-146 aa

PF07227PHD_Oberon191-308 aa

PF00628PHD207-210 aa

PF00628PHD222-274 aa

PF16312Oberon_cc398-539 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G431890	`PF16312`	Oberon_cc	134	146	6.1e-54	182.1
TkA08G431890	`PF07227`	PHD_Oberon	191	308	1.1e-37	129.5
TkA08G431890	`PF00628`	PHD	207	210	0.014	16.2
TkA08G431890	`PF00628`	PHD	222	274	0.014	16.2
TkA08G431890	`PF16312`	Oberon_cc	398	539	6.1e-54	182.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUB7`	Arabidopsis thaliana	sp\|Q9LUB7\|OBE2_ARATH Protein OBERON 2	55.500%	Swiss-Prot	High
`Q9S736`	Arabidopsis thaliana	sp\|Q9S736\|OBE1_ARATH Protein OBERON 1	54.700%	Swiss-Prot	High
`Q10PC5`	Oryza sativa subsp. japonica	sp\|Q10PC5\|TTA1_ORYSJ Protein TITANIA	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card