TkA08G431430 | RubberDandelionOmics

Gene overview

TkA08G431430

Reference: TK1151 Chr: Chr08 Coordinates: 109690600-109693428 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1035 bp · TkA08G431430|TK1151|cDNA

ATGCTCAAATCGTCCTCATCAGGGGACCCAAGATCAGTTTGGAAGGTACTCATTATGGATAAAGTTATTGTTAAAGTTATGTCAGCATCATGCAAAATGACGGATATTACAGATCAAGGAGTTTCATTGGTGGAGGACCTTTTCAAGAGAAGGCAGCCTATGCCTGCTATGGATGTTATTTATTTTATTCAACCAATTAAAGAGAACATTGTGATGTTTTTATCTGACATGTCAGGAAGAGAACCTCTATATAGAAAAGC...

CDS

Download CDS FASTA

1035 bp · TkA08G431430|TK1151|CDS

ATGCTCAAATCGTCCTCATCAGGGGACCCAAGATCAGTTTGGAAGGTACTCATTATGGATAAAGTTATTGTTAAAGTTATGTCAGCATCATGCAAAATGACGGATATTACAGATCAAGGAGTTTCATTGGTGGAGGACCTTTTCAAGAGAAGGCAGCCTATGCCTGCTATGGATGTTATTTATTTTATTCAACCAATTAAAGAGAACATTGTGATGTTTTTATCTGACATGTCAGGAAGAGAACCTCTATATAGAAAAGC...

Protein

Download Protein FASTA

344 aa · TkA08G431430|TK1151|PROTEIN

MLKSSSSGDPRSVWKVLIMDKVIVKVMSASCKMTDITDQGVSLVEDLFKRRQPMPAMDVIYFIQPIKENIVMFLSDMSGREPLYRKAFIFFSDPTPKELVSHLKNDCSVLPRIGALREMNLEYFPLESQAFTTDHDRALEYLYGKNAEKSRQSDATMITMATRIATAFASLKEFPFVWYRAKGTDGTTATTFRDLVPVKLASGIWDTISMYKTSIANFPQNETCDLLIVDRSIDLIAPIIHEWTYDAMCHDLLELEGNKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G431430`
TK1151 ID	TkA08G431430
OH-1004 ID	LXL04_034739
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.800
Protein coverage (%)	TK1151 92.151 / OH-1004 75.188 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G431430

Location Chr08:109690600-109693428 (-)

Description Similar to SEC1A: Protein transport Sec1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02010`	Involved in the vesicle trafficking.	No verified direct reference in this release
`At1g12360`	Regulator of vesicle trafficking involved in cytokinesis and root hair development, but not required for cell elongation.	No verified direct reference in this release
`At4g12120`	Involved in the vesicle trafficking.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0135900`	Involved in the vesicle trafficking.	No verified direct reference in this release
`Os04g0252400`	Involved in the vesicle trafficking.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034739 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0030141 secretory granule Cellular Component

KEGG gene cross-reference

ath:AT1G02010

ath:AT1G12360

ath:AT4G12120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.737

Rank 1 · TkA08G431430 · TK1151

Nucleus0.187

Rank 2 · TkA08G431430 · TK1151

Cell membrane0.143

Rank 3 · TkA08G431430 · TK1151

Golgi apparatus0.126

Rank 4 · TkA08G431430 · TK1151

Lysosome / Vacuole0.124

Rank 5 · TkA08G431430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00995Sec115-343 aa

PF25716BPP1_LPA106-164 aa

PF25716BPP1_LPA291-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G431430	`PF00995`	Sec1	15	343	6.7e-78	264.0
TkA08G431430	`PF25716`	BPP1_LPA	106	164	0.16	13.0
TkA08G431430	`PF25716`	BPP1_LPA	291	316	0.16	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5P7`	Arabidopsis thaliana	sp\|Q9C5P7\|SEC1A_ARATH Protein transport Sec1a	70.100%	Swiss-Prot	High
`Q9C5X3`	Arabidopsis thaliana	sp\|Q9C5X3\|KEULE_ARATH SNARE-interacting protein KEULE	67.300%	Swiss-Prot	High
`Q9SZ77`	Arabidopsis thaliana	sp\|Q9SZ77\|SEC1B_ARATH Protein transport Sec1b	55.600%	Swiss-Prot	High
`Q5VNU3`	Oryza sativa subsp. japonica	sp\|Q5VNU3\|SEC1B_ORYSJ Probable protein transport Sec1b	63.800%	Swiss-Prot	High
`Q7XWP3`	Oryza sativa subsp. japonica	sp\|Q7XWP3\|SEC1A_ORYSJ Probable protein transport Sec1a	63.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card