TkA08G428950 | RubberDandelionOmics

Gene overview

TkA08G428950

Reference: TK1151 Chr: Chr08 Coordinates: 109003202-109006326 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · TkA08G428950|TK1151|cDNA

ATATAGCCACCTAAAAGTCTTTAATATACATCGACCTTGTGGGAGAAACAAGACCCAAGACTCTTGACCGATTCAAGAATGGTAGCTTCGGCGGCCACTGGACACTCTACTTTTGTGTGTAATGCCGGTTAAGGTTCGGTAAAGGGACAAAATGGGAAAAGAATATCCGTGTTAGTTACCATCTAACAACAAATTAATTAATTCAAAATTGGCGAAGCAACTGCGAAAATTCGATGCTTTATAGGTCCAATACACGCACC...

CDS

Download CDS FASTA

561 bp · TkA08G428950|TK1151|CDS

ATGTCGATCGCAAAGAAAGGGCTTCAACAGTACTTGCTACAGCTTCAACAACATCCTTTGAGAACTAAGGCTTTGACGGCCGGAGTATTGTCGGCGATCAGTGATATCGTGTCTCAGAAGCTCTCCGGCATCCAGAAATTGCAAATCCGTCGACTTCTTCTCAAAGTGCTTTTTGGGTGTGCGTATCTTGGACCGTTTGGGCATTTCTACCACTTAATGTTGGATAAGTTGTTCAAGGGCAAAAAAGACTCGACAACAGT...

Protein

Download Protein FASTA

186 aa · TkA08G428950|TK1151|PROTEIN

MSIAKKGLQQYLLQLQQHPLRTKALTAGVLSAISDIVSQKLSGIQKLQIRRLLLKVLFGCAYLGPFGHFYHLMLDKLFKGKKDSTTVAKKVLLEQVTSSPWNNLMFMLYYGFVIEGRPWIDVKYKIKKEYPSVQYAAWTFWPVIGWINHRHVPLQFRVIVQSFVAMCWGIFLSLKARSVTLPKIKQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G428950`
TK1151 ID	TkA08G428950
OH-1004 ID	LXL04_034718
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G428950

Location Chr08:109003202-109006326 (+)

Description Similar to PMP22: Peroxisomal membrane protein PMP22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04470`	May be involved in the metabolism of reactive oxygen species.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034718 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042592 homeostatic process Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:1901858 regulation of mitochondrial DNA metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0015267 channel activity Molecular Function

KEGG gene cross-reference

ath:AT4G04470

bta:508609

ddi:DDB_G0290223

mmu:17527

rno:360463

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.502

Rank 1 · TkA08G428950 · TK1151

Peroxisome0.341

Rank 2 · TkA08G428950 · TK1151

Plastid0.040

Rank 3 · TkA08G428950 · TK1151

Cytoplasm0.039

Rank 4 · TkA08G428950 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA08G428950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19700DUF619833-45 aa

PF04117Mpv17_PMP22113-173 aa

PF19700DUF6198140-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G428950	`PF19700`	DUF6198	33	45	0.13	12.6
TkA08G428950	`PF04117`	Mpv17_PMP22	113	173	1.8e-19	70.2
TkA08G428950	`PF19700`	DUF6198	140	182	0.13	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZS51`	Arabidopsis thaliana	sp\|Q9ZS51\|PMP22_ARATH Peroxisomal membrane protein PMP22	67.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card