TkA08G427170 | RubberDandelionOmics

Gene overview

TkA08G427170

Reference: TK1151 Chr: Chr08 Coordinates: 108553200-108553836 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · TkA08G427170|TK1151|cDNA

ATGGTTTTGTGTATTTCAGCTCTCAATCCTGATAAATGGTTAGTGTTTAAGCAGCAAGAGAAGGCTAAAGTCAGTCATAATACCCAGCTATACAGGTTTTCTTTTGATCCAAATCTTGAATTGGGACTCGGTGTTGCATCATGCCTCATCACCAGGGCTCCATTGGAAGAAGATGCTGAAGGAAAAACAAAATATGTTGTTCGCCCGTATACCCCAATATCAGATCCAAATTCTAAATGTTACTTTGATTTGATGATAAA...

CDS

Download CDS FASTA

306 bp · TkA08G427170|TK1151|CDS

ATGGTTTTGTGTATTTCAGCTCTCAATCCTGATAAATGGTTAGTGTTTAAGCAGCAAGAGAAGGCTAAAGTCAGTCATAATACCCAGCTATACAGGTTTTCTTTTGATCCAAATCTTGAATTGGGACTCGGTGTTGCATCATGCCTCATCACCAGGGCTCCATTGGAAGAAGATGCTGAAGGAAAAACAAAATATGTTGTTCGCCCGTATACCCCAATATCAGATCCAAATTCTAAATGTTACTTTGATTTGATGATAAA...

Protein

Download Protein FASTA

101 aa · TkA08G427170|TK1151|PROTEIN

MVLCISALNPDKWLVFKQQEKAKVSHNTQLYRFSFDPNLELGLGVASCLITRAPLEEDAEGKTKYVVRPYTPISDPNSKCYFDLMIKIYPEGKISASIFQN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G427170`
TK1151 ID	TkA08G427170
OH-1004 ID	LXL04_002662
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.000
Protein coverage (%)	TK1151 77.228 / OH-1004 52.703 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G427170

Location Chr08:108553200-108553836 (+)

Description Similar to CBR2: NADH-cytochrome b5 reductase-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20080`	Desaturation and elongation of fatty acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002662 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002926 tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation Biological Process

GO:0006696 ergosterol biosynthetic process Biological Process

GO:0017183 protein histidyl modification to diphthamide Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H Molecular Function

GO:0005507 copper ion binding Molecular Function

KEGG gene cross-reference

afm:AFUA_2G14060

ath:AT5G20080

lel:PVL30_005544

pno:SNOG_09680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.371

Rank 1 · TkA08G427170 · TK1151

Endoplasmic reticulum0.366

Rank 2 · TkA08G427170 · TK1151

Mitochondrion0.137

Rank 3 · TkA08G427170 · TK1151

Nucleus0.135

Rank 4 · TkA08G427170 · TK1151

Cell membrane0.092

Rank 5 · TkA08G427170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21847DUF69067-21 aa

PF00970FAD_binding_619-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G427170	`PF21847`	DUF6906	7	21	0.08	13.6
TkA08G427170	`PF00970`	FAD_binding_6	19	99	4.6e-15	56.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P83291`	Arabidopsis thaliana	sp\|P83291\|NB5R2_ARATH NADH-cytochrome b5 reductase-like protein	75.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card