TkA08G426150 | RubberDandelionOmics

Gene overview

TkA08G426150

Reference: TK1151 Chr: Chr08 Coordinates: 108247609-108250350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · TkA08G426150|TK1151|cDNA

ATTGAGAGGCATAAAGTGACACGTAACAACGGCGTGTATTTGACAATTTGTACGGAAACACATCTACTTCGTCAAACTATAAAACCTCTCCAAAAACCTATCTCTATGTCAACTATTGCAATGCGCCACCGTTAATGGCCATTCTCAGATCACTTAGGAAACTTGCTCAGAAGACCTCAAACACCAGAAGCTCATTCATCTCCACTCCAAATCCAACGTCCTTGCGATCCTTAAGGTCCTCAATCGTCCTCTCTCGCTCT...

CDS

Download CDS FASTA

1014 bp · TkA08G426150|TK1151|CDS

ATGGCCATTCTCAGATCACTTAGGAAACTTGCTCAGAAGACCTCAAACACCAGAAGCTCATTCATCTCCACTCCAAATCCAACGTCCTTGCGATCCTTAAGGTCCTCAATCGTCCTCTCTCGCTCTTCAAACCTTATCTCTCGTCCTATCTCTAAGTGGGACTACCCATTTCATGGGCCGCTTTTCCTCTCATATCCTCCATGGATGCTTCTGCAATCCGCCACTCCTCTATACTTCCAATCTGAGGTCGTTTCTATCCC...

Protein

Download Protein FASTA

337 aa · TkA08G426150|TK1151|PROTEIN

MAILRSLRKLAQKTSNTRSSFISTPNPTSLRSLRSSIVLSRSSNLISRPISKWDYPFHGPLFLSYPPWMLLQSATPLYFQSEVVSIPKVRALDLLRKPKFPLKLGLRSANSEENLKDSRIAGSSVRDGLVESFVNWPNFISMSRLVSGPVLGWMIMHDMYLPAFLGLIISGATDWLDGYVARKMGINSVVGSYLDPLADKVLIGCVALAMVERGLLHSGLVALVVMRDVALVGGAVYIRASSLGSHSESRGWSDFFNLDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G426150`
TK1151 ID	TkA08G426150
OH-1004 ID	LXL04_012494
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	33.800
Protein coverage (%)	TK1151 22.849 / OH-1004 23.392 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G426150

Location Chr08:108247609-108250350 (+)

Description Similar to PGPS2: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04870`	Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG).	Cardiolipin synthase of Arabidopsis thaliana.2005 · DOI: 10.1016/j.febslet.2005.03.007

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0789100`	Catalyzes the committed step to the synthesis of the acidic phospholipids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012494 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006655 phosphatidylglycerol biosynthetic process Biological Process

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0046474 glycerophospholipid biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G39290

ath:AT3G55030

dosa:Os03g0283600

sec:SCH_1948

sgl:SG1172

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.879

Rank 1 · TkA08G426150 · TK1151

Plastid0.058

Rank 2 · TkA08G426150 · TK1151

Nucleus0.049

Rank 3 · TkA08G426150 · TK1151

Cytoplasm0.044

Rank 4 · TkA08G426150 · TK1151

Cell membrane0.016

Rank 5 · TkA08G426150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01066CDP-OH_P_transf135-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G426150	`PF01066`	CDP-OH_P_transf	135	308	1.2e-25	91.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YW7`	Arabidopsis thaliana	sp\|Q93YW7\|CRLS1_ARATH Cardiolipin synthase (CMP-forming)	59.600%	Swiss-Prot	High
`Q5N9A1`	Oryza sativa subsp. japonica	sp\|Q5N9A1\|PGPS1_ORYSJ CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic	60.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card