TkA08G422740 | RubberDandelionOmics

Gene overview

TkA08G422740

Reference: TK1151 Chr: Chr08 Coordinates: 107415741-107418769 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1620 bp · TkA08G422740|TK1151|cDNA

ATGGGTGAATCTGAGACTAAACCTCAAGTAAAACTGATTTATGATAAGGAGTATGATACGAATGAGGGATTTCAAGCGGTTAAACAGGAACAAAAACTCAGATTGGTTCAACCGATTTCATCGATGTGCGCTTCTCCTTACGTTTTACAAATAAAGAAACAGAGGGACAGAGTTATGGACGATAAGAAGGTGAGTCCGATAGTGATAGAGAATGGTGATTTCGAAGAAGAAGCTGATTGGTTGTTGGTGGGACGGAGTTA...

CDS

Download CDS FASTA

1356 bp · TkA08G422740|TK1151|CDS

ATGGGTGAATCTGAGACTAAACCTCAAGTAAAACTGATTTATGATAAGGAGTATGATACGAATGAGGGATTTCAAGCGGTTAAACAGGAACAAAAACTCAGATTGGTTCAACCGATTTCATCGATGTGCGCTTCTCCTTACGTTTTACAAATAAAGAAACAGAGGGACAGAGTTATGGACGATAAGAAGGTGAGTCCGATAGTGATAGAGAATGGTGATTTCGAAGAAGAAGCTGATTGGTTGTTGGTGGGACGGAGTTA...

Protein

Download Protein FASTA

451 aa · TkA08G422740|TK1151|PROTEIN

MGESETKPQVKLIYDKEYDTNEGFQAVKQEQKLRLVQPISSMCASPYVLQIKKQRDRVMDDKKVSPIVIENGDFEEEADWLLVGRSYGRFHRYRGKPFQIKTLKLVFSKKNIQMRKGANVVDPTFRVTRARAAACKNSEAPKDQGQDRLLCKNPKRSVQDDTNNTTNKRRAVLKDVTNICCDNSYKNCIIPAKIPKKTSKISKKNPIKPDQSIAVDHIVDLDKTVIHQKSIQIVEKESVDQIGKRVGSQLQRFSKKGRNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G422740`
TK1151 ID	TkA08G422740
OH-1004 ID	LXL04_034681
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G422740

Location Chr08:107415741-107418769 (-)

Description Similar to CYCA2-1: Cyclin-A2-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80370`	Cyclin-A2-4.	No verified direct reference in this release
`At5g25380`	May negatively regulate endocycles and act as a regulator of ploidy levels in endoreduplication.	No verified direct reference in this release
`At5g11300`	Cyclin-A2-2.	No verified direct reference in this release
`At1g15570`	Negatively regulates endocycles and acts as a regulator of ploidy levels in endoreduplication.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0502300`	Cyclin-A2-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034681 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0010389 regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0044839 cell cycle G2/M phase transition Biological Process

GO:0051301 cell division Biological Process

GO:2000123 positive regulation of stomatal complex development Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G15570

ath:AT1G80370

ath:AT5G11300

ath:AT5G25380

dosa:Os12g0502300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.827

Rank 1 · TkA08G422740 · TK1151

Cytoplasm0.223

Rank 2 · TkA08G422740 · TK1151

Mitochondrion0.039

Rank 3 · TkA08G422740 · TK1151

Cell membrane0.024

Rank 4 · TkA08G422740 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA08G422740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27057YoyE52-63 aa

PF20887PWP3A-B_N184-256 aa

PF27057YoyE203-211 aa

PF27057YoyE255-270 aa

PF00134Cyclin_N313-388 aa

PF20887PWP3A-B_N360-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G422740	`PF27057`	YoyE	52	63	7.0	7.5
TkA08G422740	`PF20887`	PWP3A-B_N	184	256	0.015	16.9
TkA08G422740	`PF27057`	YoyE	203	211	7.0	7.5
TkA08G422740	`PF27057`	YoyE	255	270	7.0	7.5
TkA08G422740	`PF00134`	Cyclin_N	313	388	2.1e-15	57.3
TkA08G422740	`PF20887`	PWP3A-B_N	360	380	0.015	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C968`	Arabidopsis thaliana	sp\|Q9C968\|CCA24_ARATH Cyclin-A2-4	37.900%	Swiss-Prot	Medium
`Q39071`	Arabidopsis thaliana	sp\|Q39071\|CCA21_ARATH Cyclin-A2-1	37.200%	Swiss-Prot	Medium
`Q147G5`	Arabidopsis thaliana	sp\|Q147G5\|CCA22_ARATH Cyclin-A2-2	38.100%	Swiss-Prot	Medium
`Q38819`	Arabidopsis thaliana	sp\|Q38819\|CCA23_ARATH Cyclin-A2-3	47.200%	Swiss-Prot	Low
`Q2QQ96`	Oryza sativa subsp. japonica	sp\|Q2QQ96\|CCA21_ORYSJ Cyclin-A2-1	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card