TkA08G417840 | RubberDandelionOmics

Gene overview

TkA08G417840

Reference: TK1151 Chr: Chr08 Coordinates: 106226341-106227639 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

969 bp · TkA08G417840|TK1151|cDNA

ATCCACAATAAAGCATTTCAAAGATAAGGTGTTGATACCATCACATATTATTTTTCTCGATTTCATTTAAAATTGCAGACAAAAACACAAGTAACAAAACAGAAGAATAACATCAATGGCAGGGCTAAGTGGTTCCTCTCTAGCGGTCTTGGAAGGGAGCCTCCAGCTCAACAACTCCACCCGTTTGACACCGGTTGTGAACAACCGCGTTGGTGTTGCCCGGTCAGGACTCGTGGTTCGAGCCCAACAAGGACAAGGTG...

CDS

Download CDS FASTA

675 bp · TkA08G417840|TK1151|CDS

ATGGCAGGGCTAAGTGGTTCCTCTCTAGCGGTCTTGGAAGGGAGCCTCCAGCTCAACAACTCCACCCGTTTGACACCGGTTGTGAACAACCGCGTTGGTGTTGCCCGGTCAGGACTCGTGGTTCGAGCCCAACAAGGACAAGGTGAAACCGAGACCAGCAGAAGAGCCGTGTTGGGACTTATCGCCACTGGTCTGGCTTCCGGTTCTTTTGTTCAGGCCGTTCTTGCGGATGCTAAACCGATCAAGCTAGGCCCACCTCC...

Protein

Download Protein FASTA

224 aa · TkA08G417840|TK1151|PROTEIN

MAGLSGSSLAVLEGSLQLNNSTRLTPVVNNRVGVARSGLVVRAQQGQGETETSRRAVLGLIATGLASGSFVQAVLADAKPIKLGPPPPPSGGLPGTENSDEARDFDLPLKKRFFIQPLAPTEAAARAKESAKEILNVKEFIDKKAWPYVQNDLRSKGQYLRYDLNTIIAAKPKEEKKQLKDLTGKLFKDMADLDYAAKIKSPADAEKSYAAAVSSLNDVLSKLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G417840`
TK1151 ID	TkA08G417840
OH-1004 ID	LXL04_034653
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G417840

Location Chr08:106226341-106227639 (+)

Description Similar to PSBQ2: Oxygen-evolving enhancer protein 3-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05180`	May participate in photosystem II assembly and stabilization.	The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions.2006 · DOI: 10.1074/jbc.m603582200
`At4g21280`	May participate in photosystem II assembly and stabilization.	The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions.2006 · DOI: 10.1074/jbc.m603582200

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P83646`	Oxygen-evolving enhancer protein 3, chloroplastic.	No verified direct reference in this release
`Os07g0544800`	Oxygen-evolving enhancer protein 3, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT4G05180

ath:AT4G21280

zma:542279

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.988

Rank 1 · TkA08G417840 · TK1151

Mitochondrion0.017

Rank 2 · TkA08G417840 · TK1151

Cytoplasm0.009

Rank 3 · TkA08G417840 · TK1151

Cell membrane0.007

Rank 4 · TkA08G417840 · TK1151

Nucleus0.007

Rank 5 · TkA08G417840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05757PsbQ20-224 aa

PF21329CYP38_PsbQ-like141-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G417840	`PF05757`	PsbQ	20	224	5.5e-72	242.9
TkA08G417840	`PF21329`	CYP38_PsbQ-like	141	200	0.027	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q41932`	Arabidopsis thaliana	sp\|Q41932\|PSBQ2_ARATH Oxygen-evolving enhancer protein 3-2, chloroplastic	69.200%	Swiss-Prot	High
`Q9XFT3`	Arabidopsis thaliana	sp\|Q9XFT3\|PSBQ1_ARATH Oxygen-evolving enhancer protein 3-1, chloroplastic	69.000%	Swiss-Prot	High
`P83646`	Oryza sativa subsp. indica	sp\|P83646\|PSBQ_ORYSI Oxygen-evolving enhancer protein 3, chloroplastic	62.500%	Swiss-Prot	High
`Q0D5P8`	Oryza sativa subsp. japonica	sp\|Q0D5P8\|PSBQ_ORYSJ Oxygen-evolving enhancer protein 3, chloroplastic	62.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card