TkA08G412680 | RubberDandelionOmics

Gene overview

TkA08G412680

Reference: TK1151 Chr: Chr08 Coordinates: 105033345-105038761 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2529 bp · TkA08G412680|TK1151|cDNA

ATGTCAATTCATGTTTTGGTCACAAAGTTGAAGGAAGAGATGTTTTCTAATACCAAAAATCACCATCTTCACTCATTTGTTTCACCATCTGCGTATGACACTGCTTGGTTAGCAATGATTCCTCATGCATTGGATCACAATAGCCCTTTGTTTAAGGGTTGCCTTGAATGGTTACTCAACAACCAAAACGAAGAAGGATACTGGGGAGAATCCATTAATGGTCTTCCCACCATTGATGCTCTTCCTGCTACTCTTGCTTC...

CDS

Download CDS FASTA

2529 bp · TkA08G412680|TK1151|CDS

ATGTCAATTCATGTTTTGGTCACAAAGTTGAAGGAAGAGATGTTTTCTAATACCAAAAATCACCATCTTCACTCATTTGTTTCACCATCTGCGTATGACACTGCTTGGTTAGCAATGATTCCTCATGCATTGGATCACAATAGCCCTTTGTTTAAGGGTTGCCTTGAATGGTTACTCAACAACCAAAACGAAGAAGGATACTGGGGAGAATCCATTAATGGTCTTCCCACCATTGATGCTCTTCCTGCTACTCTTGCTTC...

Protein

Download Protein FASTA

842 aa · TkA08G412680|TK1151|PROTEIN

MSIHVLVTKLKEEMFSNTKNHHLHSFVSPSAYDTAWLAMIPHALDHNSPLFKGCLEWLLNNQNEEGYWGESINGLPTIDALPATLASMAVLRKWGAGPQNIEKGLKFIHKNIEDILDHHHHHLPRWFFIVFPATIQLAESFGVELMFSDHTKSIISQISHDRQQIFDREEMVDKWQYPPLLAYLETFPLMKERNIDEETIINHLSEDGSLFQSPSATAQAYMSTGNRKCLDYLVSLVQKCPNGAVLEKYPMDEELVELSM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G412680`
TK1151 ID	TkA08G412680
OH-1004 ID	LXL04_034609
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 96.081 / OH-1004 87.351 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G412680

Location Chr08:105033345-105038761 (+)

Description Similar to LIS: S-linalool synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61120`	Involved in the biosynthesis of homoterpenes, attractants of herbivores parasitoids and predators (e.g. predatory mites and parasitoid wasps).	Identification and regulation of TPS04/GES, an Arabidopsis geranyllinalool synthase catalyzing the first step in the formation of the insect-induced volatile C16-homoterpene TMTT.2008 · DOI: 10.1105/tpc.106.049478

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034609 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0016102 diterpenoid biosynthetic process Biological Process

GO:0033332 ent-kaurene biosynthetic process Biological Process

GO:0080027 response to herbivore Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ag:AAC49395

ath:AT1G61120

ath:AT1G79460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.649

Rank 1 · TkA08G412680 · TK1151

Cytoplasm0.336

Rank 2 · TkA08G412680 · TK1151

Nucleus0.129

Rank 3 · TkA08G412680 · TK1151

Peroxisome0.069

Rank 4 · TkA08G412680 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA08G412680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13243SQHop_cyclase_C40-74 aa

PF01397Terpene_synth135-165 aa

PF01397Terpene_synth206-406 aa

PF03936Terpene_synth_C477-712 aa

PF19086Terpene_syn_C_2517-712 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G412680	`PF13243`	SQHop_cyclase_C	40	74	0.033	13.9
TkA08G412680	`PF01397`	Terpene_synth	135	165	3.2e-32	112.5
TkA08G412680	`PF01397`	Terpene_synth	206	406	3.2e-32	112.5
TkA08G412680	`PF03936`	Terpene_synth_C	477	712	1.2e-54	185.9
TkA08G412680	`PF19086`	Terpene_syn_C_2	517	712	1.3e-38	133.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YV0`	Arabidopsis thaliana	sp\|Q93YV0\|GES_ARATH (E,E)-geranyllinalool synthase	45.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card