TkA08G408630 | RubberDandelionOmics

Gene overview

TkA08G408630

Reference: TK1151 Chr: Chr08 Coordinates: 104003510-104008592 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2773 bp · TkA08G408630|TK1151|cDNA

GTTTGGTGTTTGAGGCTATATACAATCTCGTTTTCTTTCTCCGCCCCTGGTTTTCTTCGAAACCTACGGCCGATTTCTGTATGCGATTATCCCTGATTCTTCTCGCCCTCCCCACCGCTTTCTCCGTTCTTCTCATCCTGCCTTTTGAAGTCAATTTGGCTTTACTCCTACAAGGATCGATGCGTTTGTAGAACGCCGAAGAGGTTAACCGAAGTCCTTTTCCGATGGTCCACACGAATAATTGGGTCGAATCAGGCGAT...

CDS

Download CDS FASTA

1521 bp · TkA08G408630|TK1151|CDS

ATGCGTCCCTCCGTCCGGTCAGCGTCCGTCATTGCAGCAATCGTCGCATCCTTTCTTTTCATCTTATCGCCGGTGTTCGCGTCTGAGTATGATCACAAGTATCAACCAGATGACAAAGTCACCCTTTGGGTGAATAAAGTTGGGCCTTACAATAATCCACAAGAGACATACAATTTCTATAGTCTTCCATTTTGTCACCTACCTGGACATGCTGCACACAAGTGGGGTGGTCTTGAGATTGTGGAAAAGACCTCTGTCTG...

Protein

Download Protein FASTA

506 aa · TkA08G408630|TK1151|PROTEIN

MRPSVRSASVIAAIVASFLFILSPVFASEYDHKYQPDDKVTLWVNKVGPYNNPQETYNFYSLPFCHLPGHAAHKWGGLEIVEKTSVCKLELDEPKVMQFKQAIENNYWFELFMDDLPLWGFVGELHDRNTDNKHMLFTHMNITLQYNKDQIIHVNLTQESPKPLEAGRTLDMTYSVKWTETNITFARRFDVYLDYHFFKHQLNARNHHHQMKVNGVDHHDHEEEGFKKEMRNLAEMLSKLNPMAEEFVPPSLSNNNYNAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G408630`
TK1151 ID	TkA08G408630
OH-1004 ID	LXL04_037005
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 91.700 / OH-1004 85.455 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G408630

Location Chr08:104003510-104008592 (-)

Description Similar to CID11: Polyadenylate-binding protein-interacting protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32790`	Polyadenylate-binding protein-interacting protein 11.	No verified direct reference in this release
`At4g10610`	Binds nucleotic acids in vitro.	A new Arabidopsis nucleic-acid-binding protein gene is highly expressed in dividing cells during development.1997 · DOI: 10.1023/a:1005834402536
`At3g49390`	Polyadenylate-binding protein-interacting protein 10.	No verified direct reference in this release
`At3g14450`	Polyadenylate-binding protein-interacting protein 9.	No verified direct reference in this release
`At1g53650`	Polyadenylate-binding protein-interacting protein 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037005 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G32790

ath:AT1G53650

ath:AT3G14450

ath:AT3G49390

ath:AT4G10610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.282

Rank 1 · TkA08G408630 · TK1151

Cytoplasm0.282

Rank 2 · TkA08G408630 · TK1151

Cell membrane0.206

Rank 3 · TkA08G408630 · TK1151

Endoplasmic reticulum0.199

Rank 4 · TkA08G408630 · TK1151

Mitochondrion0.090

Rank 5 · TkA08G408630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02990EMP7082-201 aa

PF07145PAM2199-203 aa

PF07145PAM2236-251 aa

PF23085RRM_PARP14_3324-378 aa

PF16842RRM_occluded324-385 aa

PF24572RBD_RDR6325-355 aa

PF00076RRM_1328-388 aa

PF24572RBD_RDR6363-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G408630	`PF02990`	EMP70	82	201	1.8e-23	83.7
TkA08G408630	`PF07145`	PAM2	199	203	1.5e-05	25.0
TkA08G408630	`PF07145`	PAM2	236	251	1.5e-05	25.0
TkA08G408630	`PF23085`	RRM_PARP14_3	324	378	0.021	15.6
TkA08G408630	`PF16842`	RRM_occluded	324	385	0.13	12.9
TkA08G408630	`PF24572`	RBD_RDR6	325	355	0.046	14.5
TkA08G408630	`PF00076`	RRM_1	328	388	4.3e-14	52.8
TkA08G408630	`PF24572`	RBD_RDR6	363	384	0.046	14.5
TkA08G408630	`PF09063`	Phage_coat	416	467	0.096	13.3
TkA08G408630	`PF16842`	RRM_occluded	420	463	0.13	12.9
TkA08G408630	`PF23085`	RRM_PARP14_3	421	454	0.021	15.6
TkA08G408630	`PF00076`	RRM_1	423	459	4.3e-14	52.8
TkA08G408630	`PF24572`	RBD_RDR6	423	453	0.046	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPI5`	Arabidopsis thaliana	sp\|Q9LPI5\|CID11_ARATH Polyadenylate-binding protein-interacting protein 11	65.600%	Swiss-Prot	Medium
`Q9S7N9`	Arabidopsis thaliana	sp\|Q9S7N9\|CID12_ARATH Polyadenylate-binding protein-interacting protein 12	65.500%	Swiss-Prot	Medium
`Q9SG10`	Arabidopsis thaliana	sp\|Q9SG10\|CID10_ARATH Polyadenylate-binding protein-interacting protein 10	63.200%	Swiss-Prot	Medium
`Q9LRR6`	Arabidopsis thaliana	sp\|Q9LRR6\|CID9_ARATH Polyadenylate-binding protein-interacting protein 9	58.200%	Swiss-Prot	Medium
`Q9C8M0`	Arabidopsis thaliana	sp\|Q9C8M0\|CID8_ARATH Polyadenylate-binding protein-interacting protein 8	56.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card