TkA08G406120 | RubberDandelionOmics

Gene overview

TkA08G406120

Reference: TK1151 Chr: Chr08 Coordinates: 103331339-103338217 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2318 bp · TkA08G406120|TK1151|cDNA

AACCTTGGAACATGCCGTAGCAAAACGGCATCAACATGCGACCGGATTCAAGAAGTCACCTCGTAATATGTAATATCAACACGACTCCATTTGACCCATTTTGCTTCGACATTAACACGACTCCGACTGCGACTCCGGCTCCAACCCCAACTCCAGATTACAAACTCAAAATGAGCTTGCCGGAGATCGTAGAAGTTGCTCGGAATTTCTCCGTCATCATCCGAGTTCAGGGCCCTGACCCAAAAGGATTGAAGATGAGA...

CDS

Download CDS FASTA

1263 bp · TkA08G406120|TK1151|CDS

ATGCCAAACTTAAAGATATCTCCAAGAAATAAGAGGGGTGATCTTCTTGTAGCAATAGGTGCTCCATTTGGTGTCTTGTCTCCTGCCCACTTTTGTAACAGTGTATCGGTTGGTTATGTTTCCAATTGCTACCCTCCAAGTTCCTCTCACACATCATTATTGATGGCAGATATTCGATGTCTTCCAGGAATGGAAGGCAGTCCGGTTTTCGGGGAACAATCAGAGATAGTTGGCATGCTTACAAGGCCTCTGAGCCAGAG...

Protein

Download Protein FASTA

420 aa · TkA08G406120|TK1151|PROTEIN

MPNLKISPRNKRGDLLVAIGAPFGVLSPAHFCNSVSVGYVSNCYPPSSSHTSLLMADIRCLPGMEGSPVFGEQSEIVGMLTRPLSQRGSGAEVQLVIPWEAIVTSCTGFLSPNLKNPLKSHVAPSNPIEKAMSSICLVTINDGVWASGVILNHHGLILTNAHLLEPWRFSKTTISNISVTQSNPKQEPRTRTRVHQRVQVRVDNRVWCDANVVYVSKGPLDIALLKLDFVPDKLQPIVMDFSCPLLGSKVYVVGHGLFGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G406120`
TK1151 ID	TkA08G406120
OH-1004 ID	LXL04_027500
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	29.100
Protein coverage (%)	TK1151 29.762 / OH-1004 35.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G406120

Location Chr08:103331339-103338217 (+)

Description Similar to DEGP5: Protease Do-like 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28320`	Trypsin-like serine endopeptidase involved in the processing of glyoxysomal higher molecular weight precursor.	Dual specificities of the glyoxysomal/peroxisomal processing protease Deg15 in higher plants.2007 · DOI: 10.1073/pnas.0704733104 The DEG15 serine protease cleaves peroxisomal targeting signal 2-containing proteins in Arabidopsis.2008 · DOI: 10.1104/pp.108.125377 Arabidopsis LON2 is necessary for peroxisomal function and sustained matrix protein import.2009 · DOI: 10.1104/pp.109.142505

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027500 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT3G27925

ath:AT4G18370

ath:AT5G39830

syn:sll1427

syn:slr1204

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.377

Rank 1 · TkA08G406120 · TK1151

Cytoplasm0.327

Rank 2 · TkA08G406120 · TK1151

Nucleus0.184

Rank 3 · TkA08G406120 · TK1151

Peroxisome0.104

Rank 4 · TkA08G406120 · TK1151

Mitochondrion0.090

Rank 5 · TkA08G406120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13365Trypsin_27-79 aa

PF02907Peptidase_S2956-102 aa

PF00089Trypsin139-324 aa

PF13365Trypsin_2146-310 aa

PF02907Peptidase_S29281-336 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G406120	`PF13365`	Trypsin_2	7	79	2.8e-31	109.9
TkA08G406120	`PF02907`	Peptidase_S29	56	102	6.2e-07	30.0
TkA08G406120	`PF00089`	Trypsin	139	324	1.9e-08	35.1
TkA08G406120	`PF13365`	Trypsin_2	146	310	2.8e-31	109.9
TkA08G406120	`PF02907`	Peptidase_S29	281	336	6.2e-07	30.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZD4`	Arabidopsis thaliana	sp\|Q8VZD4\|DEG15_ARATH Glyoxysomal processing protease, glyoxysomal	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card