TkA08G405640 | RubberDandelionOmics

Gene overview

TkA08G405640

Reference: TK1151 Chr: Chr08 Coordinates: 103207710-103210042 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1609 bp · TkA08G405640|TK1151|cDNA

GTGACCAAGCGGCATGTTGTTTGCTTCTTCACATCGAAAACGAATTTGCTGCGCTTCATTCCTCCGAACAGCAGTAGAAAATAATCCAAACCCTAGCTAACTCTCTATCATTCATTCATCCGATCATTATTAAAGGCAGTTCCTGAGGAAAGGGAGAAAGATTAGGTTCTATTGTTCTTTAATGGGGAAAGGTACGAAATGCAAGTCTAGTTCTCACCAGATACTCAAAGACAGAGCCAAAAACCGTGTAGAGGATCTCC...

CDS

Download CDS FASTA

1137 bp · TkA08G405640|TK1151|CDS

ATGGGGAAAGGTACGAAATGCAAGTCTAGTTCTCACCAGATACTCAAAGACAGAGCCAAAAACCGTGTAGAGGATCTCCATGGCGTGTTTACAGATCTGCAGTCTGCAATAAAGGAGAGCCGTGGTATCGATGTGGCAGTGCTTGAAGAACAAGTTAACCAGATGCTAAAAGAATGGAAGAATGAACTCAATGAGCCTTCCCCTGCTTCTTCTTTGCAACAGGGTGCAAGTTTTGGGCTTTCTTCCCAGGACATAAGCAA...

Protein

Download Protein FASTA

378 aa · TkA08G405640|TK1151|PROTEIN

MGKGTKCKSSSHQILKDRAKNRVEDLHGVFTDLQSAIKESRGIDVAVLEEQVNQMLKEWKNELNEPSPASSLQQGASFGLSSQDISKLLQLCEEEDDATSRLAAPKPDPDALETTRENVAFLEEQNLKSTGEIKEELNYFSFGFSQDNNSTGQDDLIPTGFLPNISPPPCAFLGPKCALWDCPRPAQGWCPDYCSSLHGAVAHTEGCPGMKPVIRPKGIELKDTLLFAALCAKTHGKNVGVPECQGAATSKSPWNAPELF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G405640`
TK1151 ID	TkA08G405640
OH-1004 ID	LXL04_034527
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.500
Protein coverage (%)	TK1151 94.444 / OH-1004 99.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G405640

Location Chr08:103207710-103210042 (+)

Description Similar to VOZ1: Transcription factor VOZ1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28520`	Transcriptional activator acting positively in the phytochrome B signaling pathway.	VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch101 The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101915
`At2g42400`	Transcriptional activator acting positively in the phytochrome B signaling pathway.	VOZ; isolation and characterization of novel vascular plant transcription factors with a one-zinc finger from Arabidopsis thaliana.2004 · DOI: 10.1093/pcp/pch101 The phytochrome-interacting vascular plant one-zinc finger1 and VOZ2 redundantly regulate flowering in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101915

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034527 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G28520

ath:AT2G42400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA08G405640 · TK1151

Cytoplasm0.125

Rank 2 · TkA08G405640 · TK1151

Cell membrane0.044

Rank 3 · TkA08G405640 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA08G405640 · TK1151

Plastid0.019

Rank 5 · TkA08G405640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25600TRIM_CC11-61 aa

PF07464ApoLp-III13-69 aa

PF18517LZ3wCH21-52 aa

PF28235VOZ_N22-58 aa

PF18517LZ3wCH78-96 aa

PF28235VOZ_N118-125 aa

PF29201VOZ_C169-354 aa

PF02365NAM216-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G405640	`PF25600`	TRIM_CC	11	61	0.052	14.1
TkA08G405640	`PF07464`	ApoLp-III	13	69	0.077	13.9
TkA08G405640	`PF18517`	LZ3wCH	21	52	0.12	13.1
TkA08G405640	`PF28235`	VOZ_N	22	58	1.2e-20	73.5
TkA08G405640	`PF18517`	LZ3wCH	78	96	0.12	13.1
TkA08G405640	`PF28235`	VOZ_N	118	125	1.2e-20	73.5
TkA08G405640	`PF29201`	VOZ_C	169	354	8.2e-106	352.5
TkA08G405640	`PF02365`	NAM	216	337	0.00029	22.0
TkA08G405640	`PF18517`	LZ3wCH	313	323	0.12	13.1
TkA08G405640	`PF25600`	TRIM_CC	365	375	0.052	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGQ0`	Arabidopsis thaliana	sp\|Q9SGQ0\|VOZ1_ARATH Transcription factor VOZ1	59.900%	Swiss-Prot	High
`Q9SLB9`	Arabidopsis thaliana	sp\|Q9SLB9\|VOZ2_ARATH Transcription factor VOZ2	47.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card