TkA08G400200 | RubberDandelionOmics

Gene overview

TkA08G400200

Reference: TK1151 Chr: Chr08 Coordinates: 101941355-101946666 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1852 bp · TkA08G400200|TK1151|cDNA

TAAATCTTTCATAACCTTTTCTGTATAGCAAGAATACCTCGATGGTTTTTCACTAAAAGTGATTATGATGATGTTAACCCCTCTTCAAACCCCCATCAAGCTGGGTGGTTGGAAATCAGCCATTTTCATCATATTTGTGGAATTCGGAGAGAGATTTGCTTACTATGGAGTGTCGGAAATCTCATCATGTACCTAACGCTTGTTCTGAAGCAACCTCTTGCTACGGCCGGCAAAAAATGTGAACTTGTGGCACGGCGTCT...

CDS

Download CDS FASTA

1185 bp · TkA08G400200|TK1151|CDS

ATGTACCTAACGCTTGTTCTGAAGCAACCTCTTGCTACGGCCGGCAAAAAATGTGAACTTGTGGCACGGCGTCTCCGCCGTCTTTCCCGTCGTCGGTGGTTTCTTGGCAGATTCCTATTTTGGAAGATACAACATCATCTTTTCATCGATACGTATCTTTTGGGACTCATACTGTTTAATTCGGAGGAACCAATCCCATTGGAGCATCGTGCGTTCCCTTTCTTTCTAGCACTTTATATAATCAACATTGGGGAAGGTGG...

Protein

Download Protein FASTA

394 aa · TkA08G400200|TK1151|PROTEIN

MYLTLVLKQPLATAGKKCELVARRLRRLSRRRWFLGRFLFWKIQHHLFIDTYLLGLILFNSEEPIPLEHRAFPFFLALYIINIGEGGHRPCIQTFAADQFDDHLPEEKAAKSSFFNWWYLGIVLGAITAILVVIYVQDNIGWGWGFAIPAIVVAAALGVFLAGKNRYRLEAPVGSPITKVAQVIVAAARKRRLSLENDDFGMYIEAGEVGEDVTQSLARTNQFRFLDKAAIVDELDRLSGKKEDWRLCTVNEVEQVKLLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G400200`
TK1151 ID	TkA08G400200
OH-1004 ID	LXL04_034302
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.200
Protein coverage (%)	TK1151 98.731 / OH-1004 70.631 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G400200

Location Chr08:101941355-101946666 (-)

Description Similar to NPF5.4: Protein NRT1/ PTR FAMILY 5.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54450`	Protein NRT1/ PTR FAMILY 5.4.	No verified direct reference in this release
`At1g62200`	Protein NRT1/ PTR FAMILY 8.5.	No verified direct reference in this release
`At1g22540`	Protein NRT1/ PTR FAMILY 5.10.	No verified direct reference in this release
`At3g53960`	Protein NRT1/ PTR FAMILY 5.7.	No verified direct reference in this release
`At2g37900`	Protein NRT1/ PTR FAMILY 5.6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034302 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042937 tripeptide transmembrane transporter activity Molecular Function

GO:0071916 dipeptide transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22540

ath:AT1G72140

ath:AT2G37900

ath:AT3G53960

ath:AT3G54450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.375

Rank 1 · TkA08G400200 · TK1151

Endoplasmic reticulum0.285

Rank 2 · TkA08G400200 · TK1151

Lysosome / Vacuole0.195

Rank 3 · TkA08G400200 · TK1151

Cytoplasm0.090

Rank 4 · TkA08G400200 · TK1151

Golgi apparatus0.061

Rank 5 · TkA08G400200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00854PTR252-268 aa

PF07690MFS_169-164 aa

PF03169OPT99-191 aa

PF00854PTR2310-391 aa

PF07690MFS_1340-364 aa

PF03169OPT344-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G400200	`PF00854`	PTR2	52	268	1.3e-53	183.1
TkA08G400200	`PF07690`	MFS_1	69	164	2.8e-06	27.2
TkA08G400200	`PF03169`	OPT	99	191	0.031	13.7
TkA08G400200	`PF00854`	PTR2	310	391	1.3e-53	183.1
TkA08G400200	`PF07690`	MFS_1	340	364	2.8e-06	27.2
TkA08G400200	`PF03169`	OPT	344	363	0.031	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1I2`	Arabidopsis thaliana	sp\|Q9M1I2\|PTR46_ARATH Protein NRT1/ PTR FAMILY 5.4	45.000%	Swiss-Prot	Medium
`Q93Z20`	Arabidopsis thaliana	sp\|Q93Z20\|PTR17_ARATH Protein NRT1/ PTR FAMILY 8.5	38.000%	Swiss-Prot	Medium
`Q0WP01`	Arabidopsis thaliana	sp\|Q0WP01\|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10	36.900%	Swiss-Prot	Medium
`Q9M331`	Arabidopsis thaliana	sp\|Q9M331\|PTR45_ARATH Protein NRT1/ PTR FAMILY 5.7	37.200%	Swiss-Prot	Medium
`P0CI03`	Arabidopsis thaliana	sp\|P0CI03\|PTR28_ARATH Protein NRT1/ PTR FAMILY 5.6	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card