TkA08G394860 | RubberDandelionOmics

Gene overview

TkA08G394860

Reference: TK1151 Chr: Chr08 Coordinates: 100707566-100708065 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · TkA08G394860|TK1151|cDNA

ATGGAGTCTGCCCTGACACTCAAACCGGTCATCAACGTCGCTGCCATCTGCGGTTCCCTTCGCAAAGCCTCCTTCAACCAAGGTCTCATCCGTTCCGCCATCGATTTGACCAAGCAATCAGTTGATGGAATGGCTATCCAGCACCTAGACATATCGCCGTTGCCGATGCTTAACACAGATCTCGAGATCGACGGAAAATATCCACCAGCAGTCGAGGTTTTCCGTCAGAAGATTCTTCAATCCGATTGTTTCCTCTTCGC...

CDS

Download CDS FASTA

420 bp · TkA08G394860|TK1151|CDS

ATGGAGTCTGCCCTGACACTCAAACCGGTCATCAACGTCGCTGCCATCTGCGGTTCCCTTCGCAAAGCCTCCTTCAACCAAGGTCTCATCCGTTCCGCCATCGATTTGACCAAGCAATCAGTTGATGGAATGGCTATCCAGCACCTAGACATATCGCCGTTGCCGATGCTTAACACAGATCTCGAGATCGACGGAAAATATCCACCAGCAGTCGAGGTTTTCCGTCAGAAGATTCTTCAATCCGATTGTTTCCTCTTCGC...

Protein

Download Protein FASTA

139 aa · TkA08G394860|TK1151|PROTEIN

MESALTLKPVINVAAICGSLRKASFNQGLIRSAIDLTKQSVDGMAIQHLDISPLPMLNTDLEIDGKYPPAVEVFRQKILQSDCFLFASPEYNYSITAPLKNAIDWASRPPNVWADKAAAIVSAAGVFPECVPISSQVRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G394860`
TK1151 ID	TkA08G394860
OH-1004 ID	LXL04_034428
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.600
Protein coverage (%)	TK1151 91.367 / OH-1004 64.467 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G394860

Location Chr08:100707566-100708065 (+)

Description Similar to NQR: NADPH:quinone oxidoreductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27890`	The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0953600`	The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways.	No verified direct reference in this release
`Os01g0954000`	The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034428 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003955 NAD(P)H dehydrogenase (quinone) activity Molecular Function

GO:0008753 NADPH dehydrogenase (quinone) activity Molecular Function

GO:0010181 FMN binding Molecular Function

GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0050136 NADH dehydrogenase (quinone) (non-electrogenic) activity Molecular Function

GO:0052873 FMN reductase (NADPH) activity Molecular Function

KEGG gene cross-reference

ath:AT3G27890

dosa:Os01g0953600

dosa:Os01g0954000

pae:PA1204

sot:102582514

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.411

Rank 1 · TkA08G394860 · TK1151

Mitochondrion0.212

Rank 2 · TkA08G394860 · TK1151

Nucleus0.207

Rank 3 · TkA08G394860 · TK1151

Peroxisome0.172

Rank 4 · TkA08G394860 · TK1151

Plastid0.060

Rank 5 · TkA08G394860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03358FMN_red12-125 aa

PF02525Flavodoxin_214-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G394860	`PF03358`	FMN_red	12	125	3.3e-30	105.4
TkA08G394860	`PF02525`	Flavodoxin_2	14	109	2.5e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK88`	Arabidopsis thaliana	sp\|Q9LK88\|NQR_ARATH NADPH:quinone oxidoreductase	67.700%	Swiss-Prot	High
`Q941Z0`	Oryza sativa subsp. japonica	sp\|Q941Z0\|NQR1_ORYSJ Probable NADPH:quinone oxidoreductase 1	65.600%	Swiss-Prot	High
`Q941Y8`	Oryza sativa subsp. japonica	sp\|Q941Y8\|NQR2_ORYSJ Probable NADPH:quinone oxidoreductase 2	61.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card